DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynGL and Atp5l

DIOPT Version :9

Sequence 1:NP_609142.1 Gene:ATPsynGL / 34054 FlyBaseID:FBgn0031941 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_038823.2 Gene:Atp5l / 27425 MGIID:1351597 Length:103 Species:Mus musculus


Alignment Length:105 Identity:46/105 - (43%)
Similarity:61/105 - (58%) Gaps:16/105 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KAKTLVNKMIVAARPQLDEFWKYAKVELSPPLPAD----FQKLKQTAESAKLASKKDMKGQLKKS 67
            ||.::|...:..::|:|..||.||||||.||.||:    .|.:|:..:|||..|.|         
Mouse    11 KAPSMVAAAVTYSKPRLATFWHYAKVELVPPTPAEIPTAIQSVKKIIQSAKTGSFK--------- 66

  Fly    68 GLSQVTVAEAWLNVLVTVEVITWFYMGEVIGRRHLVGYKV 107
               .:||.||.||.||..||..|||:||:||:|.:|||.|
Mouse    67 ---HLTVKEAVLNGLVATEVWMWFYIGEIIGKRGIVGYDV 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynGLNP_609142.1 ATP-synt_G 12..106 CDD:282561 42/97 (43%)
Atp5lNP_038823.2 ATP-synt_G 10..101 CDD:398409 43/101 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850494
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4103
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52212
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003653
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104623
Panther 1 1.100 - - O PTHR12386
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2416
SonicParanoid 1 1.000 - - X3021
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.740

Return to query results.
Submit another query.