DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7214 and CG7203

DIOPT Version :9

Sequence 1:NP_609141.1 Gene:CG7214 / 34053 FlyBaseID:FBgn0031940 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001285713.1 Gene:CG7203 / 34055 FlyBaseID:FBgn0031942 Length:129 Species:Drosophila melanogaster


Alignment Length:162 Identity:59/162 - (36%)
Similarity:72/162 - (44%) Gaps:55/162 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFAVAVVMFVCALAGAHASWAQIAPGV-SYVSPV---AHGAGLWNGAWNGAWNGAWNGAWNGAP 61
            |||||.||:|..|       |     || |.|.|:   |||..:                     
  Fly     1 MKFAVVVVLFALA-------W-----GVNSSVVPLLTSAHGLVV--------------------- 32

  Fly    62 WGAPA---AVAVHASAAPWGL-------------TGAGWHGAAVP-GINLAQGPGLAAGHGHEGV 109
             |:||   :||:.|||.|..:             :|.....|.|| .:..|..|.:.|....|..
  Fly    33 -GSPAVAGSVAIQASAVPAAVPLSLSPAGPVLIQSGPAVVAAPVPAAVVAAHAPAVVAVAAPEAS 96

  Fly   110 YVAKTRGAIHTAPLAGHINSATSVNVAPAPGT 141
            ||||||||:|.|||.||:.||.|||:.|||||
  Fly    97 YVAKTRGAVHVAPLPGHVQSAASVNLEPAPGT 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7214NP_609141.1 Cuticle_4 81..141 CDD:374250 30/60 (50%)
CG7203NP_001285713.1 Cuticle_4 48..128 CDD:292577 31/79 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469049
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12336
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1281
43.940

Return to query results.
Submit another query.