DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp1 and CG7203

DIOPT Version :9

Sequence 1:NP_477115.1 Gene:Acp1 / 34052 FlyBaseID:FBgn0014454 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_001285713.1 Gene:CG7203 / 34055 FlyBaseID:FBgn0031942 Length:129 Species:Drosophila melanogaster


Alignment Length:137 Identity:75/137 - (54%)
Similarity:90/137 - (65%) Gaps:12/137 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFAVAVIFTLALAMGVQSSVIPLLSQVAGHGLSYTAVSGPAVVASPWAVPAAHWPAAVNVASWP 65
            |||||.|:. .|||.||.|||:|||:  :.|||   .|..|||..|. |:.|:..||||.::..|
  Fly     1 MKFAVVVVL-FALAWGVNSSVVPLLT--SAHGL---VVGSPAVAGSV-AIQASAVPAAVPLSLSP 58

  Fly    66 --PAAIHAAAPAVLAAPAP-AVVAAHAPSVVVAPVAHSGVYTAQTRGAIHTAPLAGHIQSVASIN 127
              |..|. :.|||:|||.| ||||||||: |||..|....|.|:||||:|.|||.||:||.||:|
  Fly    59 AGPVLIQ-SGPAVVAAPVPAAVVAAHAPA-VVAVAAPEASYVAKTRGAVHVAPLPGHVQSAASVN 121

  Fly   128 AAPAPGT 134
            ..|||||
  Fly   122 LEPAPGT 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp1NP_477115.1 Cuticle_4 55..134 CDD:292577 46/81 (57%)
CG7203NP_001285713.1 Cuticle_4 48..128 CDD:292577 46/81 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469048
Domainoid 1 1.000 71 1.000 Domainoid score I16382
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I7457
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm51015
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12336
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1281
76.990

Return to query results.
Submit another query.