DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp1 and CG7214

DIOPT Version :9

Sequence 1:NP_477115.1 Gene:Acp1 / 34052 FlyBaseID:FBgn0014454 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_609141.1 Gene:CG7214 / 34053 FlyBaseID:FBgn0031940 Length:142 Species:Drosophila melanogaster


Alignment Length:156 Identity:68/156 - (43%)
Similarity:81/156 - (51%) Gaps:35/156 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFAVAVI-FTLALAMGVQSS---VIPLLSQVA----GHGLSYTAVSGP-------AVVASPWAV 50
            |||||||: |..||| |..:|   :.|.:|.|:    |.||...|.:|.       |...:||..
  Fly     1 MKFAVAVVMFVCALA-GAHASWAQIAPGVSYVSPVAHGAGLWNGAWNGAWNGAWNGAWNGAPWGA 64

  Fly    51 PAA---HWPAA---VNVASWPPAAIHAAAPAVLAAPAPAVVAAHAPSVVVAPVAHSGVYTAQTRG 109
            |||   |..||   :..|.|..||:    |.:..|..|.:.|.|         .|.|||.|:|||
  Fly    65 PAAVAVHASAAPWGLTGAGWHGAAV----PGINLAQGPGLAAGH---------GHEGVYVAKTRG 116

  Fly   110 AIHTAPLAGHIQSVASINAAPAPGTL 135
            |||||||||||.|..|:|.|||||||
  Fly   117 AIHTAPLAGHINSATSVNVAPAPGTL 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp1NP_477115.1 Cuticle_4 55..134 CDD:292577 37/81 (46%)
CG7214NP_609141.1 Cuticle_4 81..141 CDD:374250 35/72 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469047
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007612
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12336
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1281
54.940

Return to query results.
Submit another query.