DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13796 and CG31904

DIOPT Version :9

Sequence 1:NP_001137807.1 Gene:CG13796 / 34051 FlyBaseID:FBgn0031939 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster


Alignment Length:280 Identity:233/280 - (83%)
Similarity:240/280 - (85%) Gaps:17/280 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKGICGEQLNNCMLLGDCENSEHGTELPGDFIGEPVETESGGGMGGSLALAARRIRSRQVHSMAV 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MKGICGEQLNNCMLLGDCENSEHGTELPGDFIGEPVETESGGGMGGSLALAARRIRSRQVHSMAV 65

  Fly    66 RTGSAYDTLERPYRHDKCRGRWAKSADFYFASCTHAFSSLIFSELSTFGILHGGWLLFIIAYLMG 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    66 RTGSAYDTLERPYRHDKCRGRWAKSADFYFASCTHAFSSLIFSELSTFGILHGGWLLFIIAYLMG 130

  Fly   131 MLFYSLPIFLIQAFLGQFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNS 195
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   131 MLFYSLPIFLIQAFLGQFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNS 195

  Fly   196 IHPVIPWMSCNNSWNTQECSLHENYDVDDYRVDPHSTVEFFRSMIASTAKGS--------TSMSI 252
            ||||||||||||||||||||||||||||      .:....|...:|...:.|        ....:
  Fly   196 IHPVIPWMSCNNSWNTQECSLHENYDVD------FAVAVIFTLALAMGVQSSVIPLLSQVAGHGL 254

  Fly   253 SWSMLIG---VLSIWLVVLA 269
            |::.:.|   |.|.|.|..|
  Fly   255 SYTAVSGPAVVASPWAVPAA 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13796NP_001137807.1 SLC5-6-like_sbd 123..610 CDD:294310 111/158 (70%)
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 104/125 (83%)
Cuticle_4 276..344 CDD:292577
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473181
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007612
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11616
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.