DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13796 and Y43D4A.1

DIOPT Version :10

Sequence 1:NP_609140.2 Gene:CG13796 / 34051 FlyBaseID:FBgn0031939 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_502983.2 Gene:Y43D4A.1 / 189850 WormBaseID:WBGene00012787 Length:91 Species:Caenorhabditis elegans


Alignment Length:61 Identity:14/61 - (22%)
Similarity:23/61 - (37%) Gaps:16/61 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 RQVHSMAVRTGSAYDTLERPYRHDKCRGRWAKSADFYFASCTHAFSSLIFSELSTFGILHG 118
            :::.:..||...:...:|.. :.|.|||.|....:|.               |||.|:..|
 Worm    26 QRIATTIVRDSGSSKEIEES-QADPCRGAWGNQIEFL---------------LSTLGMAVG 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13796NP_609140.2 SLC5-6-like_sbd 123..610 CDD:444915
Y43D4A.1NP_502983.2 SLC5-6-like_sbd 52..>90 CDD:444915 8/34 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.