DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13796 and slc6a8l

DIOPT Version :10

Sequence 1:NP_609140.2 Gene:CG13796 / 34051 FlyBaseID:FBgn0031939 Length:641 Species:Drosophila melanogaster
Sequence 2:XP_012815966.1 Gene:slc6a8l / 100127575 XenbaseID:XB-GENE-5768780 Length:654 Species:Xenopus tropicalis


Alignment Length:35 Identity:12/35 - (34%)
Similarity:15/35 - (42%) Gaps:8/35 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PSRRKSIQLSTQELIDVYQWVKQFNLSKDIKNINR 36
            ||...:||.|     |:   |...|||:....|.|
 Frog    39 PSMEPTIQNS-----DI---VFAENLSRHFYGIQR 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13796NP_609140.2 SLC5-6-like_sbd 123..610 CDD:444915
slc6a8lXP_012815966.1 SLC6sbd_CT1 61..654 CDD:271397 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.