DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13795 and Y43D4A.1

DIOPT Version :10

Sequence 1:NP_609138.3 Gene:CG13795 / 34049 FlyBaseID:FBgn0031937 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_502983.2 Gene:Y43D4A.1 / 189850 WormBaseID:WBGene00012787 Length:91 Species:Caenorhabditis elegans


Alignment Length:31 Identity:9/31 - (29%)
Similarity:15/31 - (48%) Gaps:4/31 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RGKWDKPTDFMFACFGLALKLDVFVASFWMF 50
            ||.|....:|:.:..|:|:.|    .:.|.|
 Worm    51 RGAWGNQIEFLLSTLGMAVGL----GNIWRF 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13795NP_609138.3 SLC5-6-like_sbd 27..505 CDD:271356 6/24 (25%)
Y43D4A.1NP_502983.2 SLC5-6-like_sbd 52..>90 CDD:444915 8/30 (27%)

Return to query results.
Submit another query.