DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13793 and ine

DIOPT Version :9

Sequence 1:NP_609136.2 Gene:CG13793 / 34047 FlyBaseID:FBgn0031935 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001162871.1 Gene:ine / 33659 FlyBaseID:FBgn0011603 Length:943 Species:Drosophila melanogaster


Alignment Length:522 Identity:115/522 - (22%)
Similarity:213/522 - (40%) Gaps:86/522 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 NWEKPTDYIFACFGLALKLDIFVASFWFF------FNTGIFGMVPYLMYMVIYLVPIMVIHSYMG 72
            :|.....::.||.|.::.|    .:.|.|      ...|:| :|||.:.:.|..:|::.:...:|
  Fly   339 HWANKMQFVLACIGYSVGL----GNVWRFPYMCYKSGGGVF-LVPYCIILFICSIPLLFMELSVG 398

  Fly    73 QFSSSGFISAF-RLSPLFKGMGYVSLFLTITLLIYYTIFAAVPLLFVLNSFRPTLPW-SCEGFKS 135
            |::..|.|.|. :|.|||||.|..|:.::..:..||::.....:.:...||:..:|| .|..   
  Fly   399 QYTGRGPIGALGQLCPLFKGAGLASVVVSFLMSTYYSVIIGYSIYYFFTSFKTEMPWIDCNN--- 460

  Fly   136 WQNDTIAKWSICNATIAEEVA-KETENDTYFYITNIHVPSVLYFKSHFESFQNDSELNDYEISWH 199
                   :|:..:..:.:... ..:..||      ...||..:|::.........|.... :.|.
  Fly   461 -------RWNTPDCWVPQRKGINASAPDT------SRTPSEEFFENKVLQISGGLEYPGM-MRWE 511

  Fly   200 LSGLFALVWATIAFIFYK-FSEPAKFGKCIRYMVIG-TVALLLVCFVRFLFLPGAHLGLKNYMTP 262
            |.......|..:.|..:| ....||    :||.... ...|:::..||.:.|.||..||:.:..|
  Fly   512 LFACLICAWLMVYFATWKSIKSSAK----VRYFTATFPFVLIIILMVRAVTLDGAAEGLRFFFRP 572

  Fly   263 SIEE------FVVGTSSTFIMALQAFGAGWGSVITLSSFNGFKTNIMSYSWIISFGQIFIYIMFG 321
            ...|      ::...|..|    .:.|..:||:|:.:|:|.:..||:..:..:|...:...::.|
  Fly   573 KWSELKNANVWINAASQNF----NSLGITFGSMISFASYNKYNNNILRDTVAVSAVNMITSLLVG 633

  Fly   322 MVSF-MLEHYFLGLPKPLFETQVINH--WVLFLSSASALSSLGWPNLWTFIYYTMLLMAAL---I 380
            :.:| .|.:  |.|.:......||..  .::|:....|::.:.:..||..:::.|||...|   .
  Fly   634 IFAFSTLGN--LALEQNTNVRDVIGDGPGMIFVVYPQAMAKMPYAQLWAVMFFFMLLCLGLNSQF 696

  Fly   381 VITTQIFTILQSLFDEFEQLRAKKQEVTLGLIGGLAVC---SLYFCTN---HGVLYFAILSIDAI 439
            .|...:.|.:|..|..:.:......|:.:     |.||   .|:...|   .|:.||.::...|.
  Fly   697 AIVEVVVTSIQDGFPRWIKRHLGYHEIVV-----LFVCVISCLFGMPNIIQGGIYYFQLMDHYAA 756

  Fly   440 FSQTLLHLLL--LLVVLWVYGRDRFQKDIKFMLGQP-----------------FASWKVFILRFV 485
             |.|::.|..  ::.:.|.||..|..|::|.|.|:.                 ||.|.:.::.:.
  Fly   757 -SVTIMFLAFCQMIAIAWFYGTGRLSKNVKQMTGKAPSFYLRSCWLVLGPCLLFAIWVLSLINYH 820

  Fly   486 AP 487
            .|
  Fly   821 EP 822

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13793NP_609136.2 SLC5-6-like_sbd 19..498 CDD:271356 114/517 (22%)
ineNP_001162871.1 SLC5-6-like_sbd 337..876 CDD:294310 115/522 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473200
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11616
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.