DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ntl and si:ch211-132b12.6

DIOPT Version :9

Sequence 1:NP_609135.1 Gene:Ntl / 34046 FlyBaseID:FBgn0267326 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001038523.1 Gene:si:ch211-132b12.6 / 564583 ZFINID:ZDB-GENE-050420-179 Length:577 Species:Danio rerio


Alignment Length:536 Identity:223/536 - (41%)
Similarity:334/536 - (62%) Gaps:11/536 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ERDENRGQWKSKSEFILSLLGYAIGIGNVWRFPYLCYRSGGAAFLIPYLLMVILAGIPLFYMEIL 83
            |..|.||.|..|:||:|::.|..:|:||||||||||||:||..||||||:.|:..|:|||.:|..
Zfish     6 EEIEERGFWGKKAEFLLAVAGNVVGLGNVWRFPYLCYRNGGGVFLIPYLVFVVTCGLPLFLLETA 70

  Fly    84 IGQFS-STGCTGMFRMTPLLKGTGIAQVVVNAYCVCYYSVIISYPIRMIFYCFFKKVPWEDCSNS 147
            :|||: ..|.|...|:.||.:|.|.|..:...|...||::|:::.:..:...|..::||..|:|.
Zfish    71 MGQFTHEGGITCWHRLCPLAQGVGYAGQLTVLYSCMYYTIILAWALFYLVSSFSSQLPWVSCNNI 135

  Fly   148 WNTDDCV--TASDMGKQNSSDVFKTS-ADEFFHLEVLRISTDISDLGGMVWEQLTALIITWIIIY 209
            ||||:||  .|.::....::....|| |.||:...||.:|..|.|:|.:.||.|..||..|||.|
Zfish   136 WNTDNCVNLAAGNLTFNRTTLANSTSAATEFWERRVLSLSGGIEDIGKINWEILLCLIAMWIICY 200

  Fly   210 FCLMRGIKSVGKVVYFTVPFPYLLLFILLIRGATLPGAWKGIKFYLYPEWHRLLDLKVWADAAVQ 274
            ||:.:|:||.|||||||..|||::|.:|||||.|||||.:|:.||||||..||.|.:||.:|..|
Zfish   201 FCIWKGVKSTGKVVYFTATFPYVMLLVLLIRGLTLPGALQGVVFYLYPEPARLADPQVWMEAGTQ 265

  Fly   275 MFFGIGPGWGGIVNMASFSSFRNNAKCDSVLIVSINVFTSLLAGFVVFSVLGFLSEKSGIPVESV 339
            :||......|.::::.|::.:.||...||..:..:|..||.:|||.|||||||::...|:|||.|
Zfish   266 VFFSYSVCSGILISLGSYNQYSNNCYRDSFWLCLLNSGTSFVAGFAVFSVLGFMAHVQGVPVEEV 330

  Fly   340 ATGGAGLAFVTYPEAIALLPVPQLWALMFFFMLFLLGIDSVFVQLEAIMSSILDEWYWV--RSHK 402
            |..|.||||:.||:|:|::|.|||||:.||.|:.|||:||.||.:|.:::|::|.:..|  |:.:
Zfish   331 AESGPGLAFIAYPQAMAMMPFPQLWAVCFFIMIILLGLDSQFVGIECVITSVMDLFPEVLRRAGR 395

  Fly   403 CKL-TLISCL-IFLGLSSIMCTNGGMFILQLFDWYS-SAIAVIVICLVEIIMVAWIYGIKNFMLD 464
            .:| .|:.|| .|.| ..||.|.|||::.||||.|: :...::.:.:.|.:.:.|::|.:.....
Zfish   396 RELFVLLLCLTCFFG-QLIMVTEGGMYVFQLFDNYACNGACLLFLSVFESLAIGWLFGAEKMFDI 459

  Fly   465 VEFMLGKRPTLYWRIVWQVVTPVIIIFILITSIVFIRTITYNN-IPYPQWAIIIGWASCFTSVMW 528
            :|.|...||..::.:.|:.:||::.:...:.|:|....:|:|. ..||.||..:||....:|::.
Zfish   460 IEDMTESRPNYWFMLCWKYLTPLVSLMSFVYSMVRYTPLTFNRWYVYPDWAYALGWLLALSSILL 524

  Fly   529 IPLYIFYIMIRKRATL 544
            :|.:....|...:.||
Zfish   525 VPGWALGQMWAGKGTL 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtlNP_609135.1 SLC5-6-like_sbd 24..554 CDD:294310 221/531 (42%)
si:ch211-132b12.6NP_001038523.1 SLC6sbd-TauT-like 11..550 CDD:271387 221/531 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.