DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ntl and CG1698

DIOPT Version :9

Sequence 1:NP_609135.1 Gene:Ntl / 34046 FlyBaseID:FBgn0267326 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001260835.1 Gene:CG1698 / 36006 FlyBaseID:FBgn0033443 Length:654 Species:Drosophila melanogaster


Alignment Length:569 Identity:204/569 - (35%)
Similarity:339/569 - (59%) Gaps:30/569 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ENRGQWKSKSEFILSLLGYAIGIGNVWRFPYLCYRSGGAAFLIPYLLMVILAGIPLFYMEILIGQ 86
            :.|..|.:..||::|.:..::|:|||||||:....:||.||:||||:::||.|.|::|:|:|:||
  Fly    72 KKRDSWNNDIEFLMSCIALSVGLGNVWRFPFTALENGGGAFVIPYLIVLILVGKPVYYLEMLLGQ 136

  Fly    87 FSSTGCTGMFRMTPLLKGTGIAQVVVNAYCVCYYSVIISYPIRMIFYCFFKKVPWEDCSNSWNTD 151
            |||.|...::..:|:::|.|..||:.......||:.:::..:|.....|:..:||..|...|.| 
  Fly   137 FSSRGSVKVYDFSPIMRGIGYGQVLATGIVTTYYATLMALTLRYFVDSFYPTLPWSYCREEWGT- 200

  Fly   152 DCVTASDMGKQNS--------SDVFKTSADEFFHLEVLRISTDISD-LGGMVWEQLTALIITWII 207
            :|:   |.|.|.:        |.|..|||:.:|...:||....|.| :|...|....||.:.||:
  Fly   201 ECL---DSGPQEASRATSLAGSGVRTTSAEFYFTNIILREKASIDDGIGYPSWSLALALAVAWIV 262

  Fly   208 IYFCLMRGIKSVGKVVYFTVPFPYLLLFILLIRGATLPGAWKGIKFYLYPEWHRLLDLKVWADAA 272
            |...:.:|:||.||..||...|||:::.:||:|..|||||:.|:.::|.|:||:||:.:||..|.
  Fly   263 IAGIMFKGVKSSGKASYFLALFPYVVMLVLLVRALTLPGAFDGVLYFLRPQWHKLLEPQVWYAAV 327

  Fly   273 VQMFFGIGPGWGGIVNMASFSSFRNNAKCDSVLIVSINVFTSLLAGFVVFSVLGFLS-EKSGIPV 336
            .|:||.:...:|.|:..||::.|.:|...|:.::.:::.|||||:|.::|.:||.|: |.:...:
  Fly   328 TQVFFSLAICFGNIIMYASYNRFGHNIYRDANIVTTLDTFTSLLSGVIIFGILGNLAYENNTTDI 392

  Fly   337 ESVATGGAGLAFVTYPEAIALLP-VPQLWALMFFFMLFLLGIDSVFVQLEAIMSSILDEWYWVRS 400
            .||..||.||||::||:|||... :|||::::||.|||:|||.| .|.:.:.||:::.:.:   .
  Fly   393 ASVVNGGPGLAFISYPDAIAKFKWLPQLFSVLFFLMLFVLGIGS-NVGMASCMSTVIKDQF---G 453

  Fly   401 HKCKLTLISCLIFLG--LSSIMCTNGGMFILQLFDWYSSAIAVIVICLVEIIMVAWIYGIKNFML 463
            |....|::..:..:|  |..:..|.||.|:|.|.|::......:|:.:.|::.:|||||:|....
  Fly   454 HLKNWTVVVGIAIVGYFLGLLYITPGGQFLLNLVDYFGVTFVALVLAIFELVTIAWIYGVKRLCR 518

  Fly   464 DVEFMLGKRPTLYWRIVWQVVTPVIIIFILITSIVFIRTITYNNIPYPQWAIIIGWASCFTSVMW 528
            |||||:|.:.:||:||.|.||||::::.|||.::|....:.|.:..|.....:.||  |. |...
  Fly   519 DVEFMIGIKTSLYYRICWAVVTPLLMLTILIYTLVLYEPLKYKDYTYQSGVYVFGW--CL-SAFG 580

  Fly   529 IPLYIFYIM--IRKRAT---LCDSLKKRLKPL-DWTPADPQDRAEYEAF 571
            :...:|:.:  :||:.:   |...::|..:|| :|.|:|||....|:.|
  Fly   581 VGQVLFWAIPAVRKQPSHLGLWARIRKAFEPLPNWGPSDPQTLKRYQLF 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtlNP_609135.1 SLC5-6-like_sbd 24..554 CDD:294310 195/547 (36%)
CG1698NP_001260835.1 SLC6sbd 75..552 CDD:271359 182/484 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440755
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11616
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.