DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ntl and CG31904

DIOPT Version :10

Sequence 1:NP_609135.1 Gene:Ntl / 34046 FlyBaseID:FBgn0267326 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster


Alignment Length:169 Identity:47/169 - (27%)
Similarity:78/169 - (46%) Gaps:21/169 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DKRIERDENRGQWKSKSEFILSLLGYAIG---IGNVWRFPYLCYRSGGAAFLIPYLLMVILAGIP 76
            ::....|:.||:|...::|..:...:|..   ...:..|..|  ..|...|:|.||:.::...:|
  Fly    75 ERPYRHDKCRGRWAKSADFYFASCTHAFSSLIFSELSTFGIL--HGGWLLFIIAYLMGMLFYSLP 137

  Fly    77 LFYMEILIGQFSSTGCTGMFRMTPLLKGTGIAQVVVNAYCVCYYSVIISYPIRMIFYCFFKKVPW 141
            :|.::..:|||||:|....||:.|:.||.|.|.:::|...:.|||:....|:..........:||
  Fly   138 IFLIQAFLGQFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPW 202

  Fly   142 EDCSNSWNTDDC----------------VTASDMGKQNS 164
            ..|:|||||.:|                ..|..||.|:|
  Fly   203 MSCNNSWNTQECSLHENYDVDFAVAVIFTLALAMGVQSS 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtlNP_609135.1 SLC5-6-like_sbd 24..554 CDD:444915 46/160 (29%)
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:444915 38/119 (32%)
Cuticle_4 276..344 CDD:464954
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.