DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ntl and si:ch211-132b12.1

DIOPT Version :9

Sequence 1:NP_609135.1 Gene:Ntl / 34046 FlyBaseID:FBgn0267326 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001076533.1 Gene:si:ch211-132b12.1 / 100034467 ZFINID:ZDB-GENE-050420-315 Length:586 Species:Danio rerio


Alignment Length:579 Identity:232/579 - (40%)
Similarity:351/579 - (60%) Gaps:26/579 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ENRGQWKSKSEFILSLLGYAIGIGNVWRFPYLCYRSGGAAFLIPYLLMVILAGIPLFYMEILIGQ 86
            |.||.|.||.||:|::.|..:|:|||||||||||:.||.|||||||:.|:..|:|||.:|:.:||
Zfish     9 EERGYWGSKMEFLLAVAGNVVGLGNVWRFPYLCYKYGGGAFLIPYLVFVVTCGVPLFLLEMAMGQ 73

  Fly    87 FSST-GCTGMFRMTPLLKGTGIAQVVVNAYCVCYYSVIISYPIRMIFYCFFKKVPWEDCSNSWNT 150
            ::.. |.|...|:.||.:|.|....::..|...||.||:::.:..:.:.|..::||..|.|:|||
Zfish    74 YTQQGGVTCWHRLCPLAEGIGYGGQLILLYSCMYYIVILAWALFYLIFSFKSQLPWATCDNTWNT 138

  Fly   151 DDCV--TASDMGKQNSSDVFKT-SADEFFHLEVLRISTDISDLGGMVWEQLTALIITWIIIYFCL 212
            |||:  ...::....:|.:..| :|.||:...||.:|..|.|:|.:.||.|..||..|||.|||:
Zfish   139 DDCINLVTKNLTINRTSLINSTPAATEFWERRVLSLSGGIEDIGKINWEILLCLIAMWIICYFCV 203

  Fly   213 MRGIKSVGKVVYFTVPFPYLLLFILLIRGATLPGAWKGIKFYLYPEWHRLLDLKVWADAAVQMFF 277
            .:|:||.|||||||..|||::|.:|||||.|||||.:|:.||||||..||.|.:||.:|..|:.|
Zfish   204 WKGVKSTGKVVYFTATFPYVMLLVLLIRGLTLPGALQGVVFYLYPEPARLADPQVWLEAGTQILF 268

  Fly   278 GIGPGWGGIVNMASFSSFRNNAKCDSVLIVSINVFTSLLAGFVVFSVLGFLSEKSGIPVESVATG 342
            ......|.|..:||::.:.||...|.:.:..:|..||.:|||.||:||||::::.|:|:|.||..
Zfish   269 SYSVSVGSITVLASYNKYHNNCYRDCLGLCLLNSVTSFVAGFAVFTVLGFMAQEQGVPIEEVAES 333

  Fly   343 GAGLAFVTYPEAIALLPVPQLWALMFFFMLFLLGIDSVFVQLEAIMSSILDEWYWVRSHKCK--- 404
            |.||||:.||:|:|::|.|||||:.||.|:.|||:|:.||.:||:::|::|.:..|...:.:   
Zfish   334 GPGLAFIAYPQAVAMMPFPQLWAVCFFIMIILLGLDTQFVSMEAVVTSVMDMFPVVLRREGRREI 398

  Fly   405 LTLISCL-IFLGLSSIMCTNGGMFILQLFDWYS-SAIAVIVICLVEIIMVAWIYGIKNFMLDVEF 467
            |.|..|| .|.| ..||.|.|||::.||||:|: :...::.:.:.|.:.:.||:|.......:|.
Zfish   399 LLLFFCLTCFFG-QFIMVTEGGMYVFQLFDYYACNGTCLLFLSVFESLTMGWIFGADRLFDIIED 462

  Fly   468 MLGKRPTLYWRIVWQVVTPVIIIFILITSIVFIRTITYNN-IPYPQWAIIIGWASCFTSVMWIPL 531
            |...||...:.:.|:.:||::.:...:.|:|..:.:|:|. ..:|.||.::||....:|::.:|.
Zfish   463 MTKSRPNYIFMLCWKYLTPLVSLVCFVCSMVEYQPLTFNRWYVFPDWAYVLGWLLALSSIVLVPG 527

  Fly   532 YIFYIMIRKRATLCD---SLKKRLKPLDWTPADPQDRAEYEAFRRQRRMPGFMSDTDME 587
            :..       ..||.   |||:|.:.|  ..|| :|.......|.|.:...||  |:||
Zfish   528 WAL-------GRLCSEKGSLKQRWRRL--CSAD-KDLPLTCKQRAQLKETAFM--TEME 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtlNP_609135.1 SLC5-6-like_sbd 24..554 CDD:294310 220/542 (41%)
si:ch211-132b12.1NP_001076533.1 SLC6sbd-TauT-like 11..549 CDD:271387 221/547 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.