DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tep3 and AI182371

DIOPT Version :9

Sequence 1:NP_523507.2 Gene:Tep3 / 34045 FlyBaseID:FBgn0041181 Length:1469 Species:Drosophila melanogaster
Sequence 2:XP_017174840.1 Gene:AI182371 / 98870 MGIID:2138853 Length:366 Species:Mus musculus


Alignment Length:364 Identity:79/364 - (21%)
Similarity:135/364 - (37%) Gaps:103/364 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QGLYSIIAPNTLRPNSQFHVAVSLHNAPESATFKVGILGSSYTD------FKTVELRPFSTQLLH 86
            |..|.|..|...|..:..:|.|..|...|:  |...:...||.|      |.||.|.|.:    .
Mouse    39 QTRYIISTPIVFRVGAPENVTVQAHGHTEA--FDTTVSVKSYPDENVRYSFSTVNLSPEN----K 97

  Fly    87 FEIPALRTDRYRLTAEGLGGVQFTNE----TQLHFESKQ--------HTVLVQTDKSIYKPGDLV 139
            |:..|:.|.:.:..:||..  .|:|.    ...||...:        .::.||||||:|.|...|
Mouse    98 FQNTAILTIQAKQLSEGQN--SFSNSYLEVVSKHFAKLEIVPIIYDNDSLFVQTDKSVYTPQQPV 160

  Fly   140 HYRVLILDANLKPA-RGYGRVHVDIKDS------GDNI--IRSYKDIRLTNSIYSNELRLSDSPR 195
            ..||..::.:|:|| |......:|.:.|      |:|:  |.|:.|..:.:           :|:
Mouse   161 KVRVYSVNDDLEPATRETVLTFIDPEGSQVDTIEGNNLTGIASFPDFEIPS-----------NPK 214

  Fly   196 FGTWSIVV----DVSD--------QEHTQTFEILDHILPKFVVDIDTPKHAIY------------ 236
            .|.|::..    |.|.        :|:.:|:.|  .|:|...:..:..|...:            
Mouse   215 HGRWTVKAKYREDASKTGTTYFEVKEYDKTYRI--SIMPTIDLQPEVEKQEAHGMCLHQPTECLR 277

  Fly   237 -KDGKIAATVRAHYAFGQPIVGE-----ATLSIYPTFFGSLQPFVNDLITRKVVPIDGNAY---- 291
             |..:.|:|      :..|::.:     |..:|:.|       .|......|:.||...|:    
Mouse   278 QKINEQAST------YKHPMIKKCCYDGARYNIHET-------CVQRAARVKIGPICVKAFTLCC 329

  Fly   292 ------FEFDIENELHLKQDYERQYLLDALVEEKSTGSV 324
                  .|......:||.....:.:.:  ::|.|::|.|
Mouse   330 NMAHQILENSTFKHIHLSSHCFKSFKM--ILENKASGHV 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tep3NP_523507.2 A2M_N 124..215 CDD:280081 29/111 (26%)
A2M_N_2 448..573 CDD:285005
A2M 697..787 CDD:278630
A2M_2 918..1203 CDD:239227
A2M_comp 967..1200 CDD:284982
A2M_recep 1313..1402 CDD:284981
AI182371XP_017174840.1 MG1 42..138 CDD:375333 26/103 (25%)
A2M_N 145..238 CDD:376626 27/103 (26%)
ANATO 279..347 CDD:237984 14/80 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840000
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2373
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.