DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tep3 and A2m

DIOPT Version :10

Sequence 1:NP_523507.2 Gene:Tep3 / 34045 FlyBaseID:FBgn0041181 Length:1469 Species:Drosophila melanogaster
Sequence 2:NP_783327.2 Gene:A2m / 232345 MGIID:2449119 Length:1474 Species:Mus musculus


Alignment Length:116 Identity:23/116 - (19%)
Similarity:43/116 - (37%) Gaps:41/116 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   784 SNLTPAERLHAYFLLCSDVVSNGASRTGCLVMLKRELSDGIR-------LSLLDWRRATDNACER 841
            |:.:|..|.|..:..|:|                   :.|||       |:.|.         ::
Mouse   108 SDGSPTHRRHIKYTSCND-------------------NHGIRPPPPEQYLTPLQ---------QK 144

  Fly   842 DRIVRRLQL-LKQAYLGTL-RCLSHSCDLTQLANERKRIFQLWTEPSCSRL 890
            :..:|.|:. ||:    |: |......::.:|..:..|:.:.|.|..|.|:
Mouse   145 EVCIRHLRARLKE----TIERLQDRDSEIDELRTQLTRMQEDWIEEECHRV 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tep3NP_523507.2 YfaS <128..1399 CDD:441940 23/116 (20%)
A2M_2 918..1203 CDD:239227
A2mNP_783327.2 YfaS <135..1330 CDD:441940 14/70 (20%)
MG4 356..451 CDD:465507
Bait region. /evidence=ECO:0000250|UniProtKB:P01023 623..752
A2M 738..828 CDD:459711
TED_complement 948..1264 CDD:462227
A2M_recep 1374..1464 CDD:462226
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.