DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tep3 and LOC101886227

DIOPT Version :9

Sequence 1:NP_523507.2 Gene:Tep3 / 34045 FlyBaseID:FBgn0041181 Length:1469 Species:Drosophila melanogaster
Sequence 2:XP_021322237.1 Gene:LOC101886227 / 101886227 -ID:- Length:140 Species:Danio rerio


Alignment Length:125 Identity:28/125 - (22%)
Similarity:52/125 - (41%) Gaps:22/125 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IAPNTLRPNSQFHVAVSLHNAPESATFKVGILGSSYTDFKTVELRPFSTQLLH----FEIPALRT 94
            :..:.|:||....:.:.|.::.:|                |:.|:..:.|..|    |:.|....
Zfish    16 LCASLLKPNKTLFMNIYLVHSNQS----------------TLLLQEKAEQEFHRCFNFQAPLAEA 64

  Fly    95 DRYRLTAEGLGGVQF--TNETQLHFESKQHTVLVQTDKSIYKPGDLVHYRVLILDANLKP 152
            :..:.....|.|..|  |.|.::.|:|......:|.||..|..|..|::||:.:|.:.:|
Zfish    65 ESVQKIKVELQGESFNMTEERKVMFKSYHPLTFIQMDKPFYIAGQTVNFRVVTMDKSFRP 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tep3NP_523507.2 A2M_N 124..215 CDD:280081 10/29 (34%)
A2M_N_2 448..573 CDD:285005
A2M 697..787 CDD:278630
A2M_2 918..1203 CDD:239227
A2M_comp 967..1200 CDD:284982
A2M_recep 1313..1402 CDD:284981
LOC101886227XP_021322237.1 A2M_N 96..>135 CDD:327702 10/29 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D177369at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.