DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tep3 and WASHC1

DIOPT Version :9

Sequence 1:NP_523507.2 Gene:Tep3 / 34045 FlyBaseID:FBgn0041181 Length:1469 Species:Drosophila melanogaster
Sequence 2:XP_011515961.1 Gene:WASHC1 / 100287171 HGNCID:24361 Length:474 Species:Homo sapiens


Alignment Length:339 Identity:65/339 - (19%)
Similarity:102/339 - (30%) Gaps:105/339 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 RTAYSLDASGEIKMKFTVP--IGDRDEFHSIIVDYQGVISEVGKIPSKHLHSKNYITAKVLNDRP 454
            :|...|.|..|.|: |..|  |..|::....:.:....:.::|::|..|:.|       .|.|.|
Human   207 KTHVMLGAETEEKL-FDAPLSISKREQLEQQVPENYFYVPDLGQVPEIHVPS-------YLPDLP 263

  Fly   455 TVNQEISVVVRSFAPIKYFMYQV-VGRGDIILSRNVDVAPGTFHTIKFLASFAMMPRANLLVYTV 518
            .:..::             ||.. :|.|         :||....||..|.:|             
Human   264 GIANDL-------------MYSADLGPG---------IAPSAPGTIPELPTF------------- 293

  Fly   519 IDGEFVYDEQVIQLEENLLNAVQVDAPIRAPPGQDIDIGISTKPYSYVGLMLVDQNANDLRSGHD 583
                  :.|....|:.:|.:.|....|...||....::..|..|........|.|.|....|...
Human   294 ------HTEVAEPLKVDLQDGVLTPPPPPPPPPPAPEVLASAPPLPPSTAAPVGQGARQDDSSSS 352

  Fly   584 LTHK----------------RLMDALRSYELSDVNTPMGSPGKESGVITMSNTDYFIEKEAESNP 632
            .:..                .|::::|.         .|..||..   ..|..:..:||:.:...
Human   353 ASPSVQGAPREVVDPSGGWATLLESIRQ---------AGGIGKAK---LRSMKERKLEKQQQKEQ 405

  Fly   633 ALDREVSTGPE-----EDKLTTVRKTDIGPAHKIEVNTLPPGKG--------RYAFSYTPKPFWH 684
            ...|..|.|..     .:||...||...|..         ||.|        |.:.|..|.|...
Human   406 EQVRATSQGGHLMSDLFNKLVMRRKGISGKG---------PGAGEGPGGAFVRVSDSIPPLPPPQ 461

  Fly   685 NPRVHVMRDPADTW 698
            .|:.   .:..|.|
Human   462 QPQA---EEDEDDW 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tep3NP_523507.2 A2M_N 124..215 CDD:280081
A2M_N_2 448..573 CDD:285005 23/125 (18%)
A2M 697..787 CDD:278630 1/2 (50%)
A2M_2 918..1203 CDD:239227
A2M_comp 967..1200 CDD:284982
A2M_recep 1313..1402 CDD:284981
WASHC1XP_011515961.1 WASH_WAHD 59..306 CDD:288773 28/147 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2373
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.