Sequence 1: | XP_024302914.1 | Gene: | POTEA / 340441 | HGNCID: | 33893 | Length: | 559 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_524367.1 | Gene: | Act88F / 41885 | FlyBaseID: | FBgn0000047 | Length: | 376 | Species: | Drosophila melanogaster |
Alignment Length: | 232 | Identity: | 45/232 - (19%) |
---|---|---|---|
Similarity: | 84/232 - (36%) | Gaps: | 57/232 - (24%) |
- Green bases have known domain annotations that are detailed below.
Human 152 LQHGTDPNLPDMYGNTALHYAVYNEDKLMAK--TLLLYGADIESK-NKGGLTPLLLAVHGQKQRM 213
Human 214 VKFLIKKKANLNALDRFGRTALILAVRCGSASIVSL---------LLQQNIDVFSQDV------- 262
Human 263 -------FGQTAEDYAVSSHHSIICQLLSDYKENQMPNNSSGNSNPEQDLKLTSEE--------- 311
Human 312 -------EPQRLKGSENSQHEKVTQ-----EPDINKD 336 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
POTEA | XP_024302914.1 | ANK | 93..218 | CDD:238125 | 16/68 (24%) |
ANK repeat | 100..129 | CDD:293786 | |||
ANK repeat | 133..162 | CDD:293786 | 3/9 (33%) | ||
ANK | 159..283 | CDD:238125 | 31/149 (21%) | ||
ANK repeat | 164..195 | CDD:293786 | 8/33 (24%) | ||
ANK repeat | 197..228 | CDD:293786 | 5/30 (17%) | ||
ANK repeat | 230..261 | CDD:293786 | 6/39 (15%) | ||
SMC_N | <302..538 | CDD:330553 | 11/56 (20%) | ||
CCDC144C | 452..>559 | CDD:317340 | |||
Act88F | NP_524367.1 | PTZ00281 | 1..376 | CDD:173506 | 45/232 (19%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |