DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tep2 and AI182371

DIOPT Version :9

Sequence 1:NP_523506.1 Gene:Tep2 / 34044 FlyBaseID:FBgn0041182 Length:1420 Species:Drosophila melanogaster
Sequence 2:XP_017174840.1 Gene:AI182371 / 98870 MGIID:2138853 Length:366 Species:Mus musculus


Alignment Length:224 Identity:53/224 - (23%)
Similarity:90/224 - (40%) Gaps:25/224 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YSVVGPGTLRSNSKYNVVVSVHKADGPSQIKVSLNG-PSYNETKQIELPPMSTQN-------VEF 79
            |.:..|...|..:..||.|..|.........||:.. |..|.........:|.:|       :..
Mouse    42 YIISTPIVFRVGAPENVTVQAHGHTEAFDTTVSVKSYPDENVRYSFSTVNLSPENKFQNTAILTI 106

  Fly    80 EVPKLATGNYNLSAEGVSGVVFKNSTKLNYAD---KKPSVFVQTDKATYKPADLVQFRILFLDEN 141
            :..:|:.|..:.|...:. ||.|:..||....   ...|:||||||:.|.|...|:.|:..::::
Mouse   107 QAKQLSEGQNSFSNSYLE-VVSKHFAKLEIVPIIYDNDSLFVQTDKSVYTPQQPVKVRVYSVNDD 170

  Fly   142 TRPAKIEKPISVIIIDGAQNRIKQLSDVKLTKGVFS-GELQLSEQPVLGTWKISVSV--DGDNRE 203
            ..||..|..::.|..:|:|  :..:....|| |:.| .:.::...|..|.|.:....  |.....
Mouse   171 LEPATRETVLTFIDPEGSQ--VDTIEGNNLT-GIASFPDFEIPSNPKHGRWTVKAKYREDASKTG 232

  Fly   204 TKSFEVDKY-------VLPKFEVIVDTPK 225
            |..|||.:|       ::|..::..:..|
Mouse   233 TTYFEVKEYDKTYRISIMPTIDLQPEVEK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tep2NP_523506.1 A2M_N 115..209 CDD:280081 27/96 (28%)
A2M_N_2 445..576 CDD:285005
A2M 694..782 CDD:278630
A2M_2 909..1198 CDD:239227
A2M_comp 961..1199 CDD:284982
A2M_recep 1308..1398 CDD:284981
AI182371XP_017174840.1 MG1 42..138 CDD:375333 21/96 (22%)
A2M_N 145..238 CDD:376626 26/95 (27%)
ANATO 279..347 CDD:237984
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840001
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2373
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.