DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7025 and AGBL2

DIOPT Version :9

Sequence 1:NP_609133.2 Gene:CG7025 / 34042 FlyBaseID:FBgn0031930 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_079059.2 Gene:AGBL2 / 79841 HGNCID:26296 Length:902 Species:Homo sapiens


Alignment Length:514 Identity:100/514 - (19%)
Similarity:164/514 - (31%) Gaps:206/514 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IVLALVVLAQGASFGQDERL----RYDNYSVYK-VKFETQAQRSILR-KLAEDREN----FRLWH 62
            ||..|.|..||.   :|..|    |:::.::.| |:.:|......|| .|..::..    ||:.:
Human   250 IVKELAVTLQGP---EDNTLLFESRFESGNLQKAVRVDTYEYELTLRTDLYTNKHTQWFYFRVQN 311

  Fly    63 EAKDELHL-----MLSPGAFGELETEIQKTNVTAELFISNVQELIDSEEAANLKASRDGTFGWTK 122
            ..||..:.     :|.|                ..|:...::.|:.|:..||.:     ..||.:
Human   312 TRKDATYRFTIVNLLKP----------------KSLYTVGMKPLLYSQLDANTR-----NIGWRR 355

  Fly   123 YNSLAEIY--------------AWL-------DDILAA--YP---TITESFIVG----------- 150
            ..:..:.|              .|.       |....|  ||   |..:.:::.           
Human   356 EGNEIKYYKNNTDDGQQPFYCLTWTIQFPYDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFC 420

  Fly   151 ------QSYEGRTIRGIKISYKSNNP-------GVLIESNIHAREWITSATATWLINEFL----- 197
                  :|..|.|:..:.|:..|..|       .|::.:.:|..|    :..:|::..||     
Human   421 KLQTLCRSLAGNTVYLLTITNPSQTPQEAAAKKAVVLSARVHPGE----SNGSWVMKGFLDFILS 481

  Fly   198 TSTD-ELVRDLAENHDWYIVPVLNVDGFVYTHEKDRMWRKTRQPSEISSCIGADPNRNYDSHWME 261
            .|.| :|:||:   ..:.::|:||.||.:..:.:             .|..|.|.||:|.:...|
Human   482 NSPDAQLLRDI---FVFKVLPMLNPDGVIVGNYR-------------CSLAGRDLNRHYKTILKE 530

  Fly   262 NEGASSNPCAEDYGGPKPFSEPEIQAMSEFVISIKDKINVLL--AFHSYSQ---LLLSPYGHTKE 321
                 |.||              |......:..:.::..|||  .||.:|:   :.|  ||....
Human   531 -----SFPC--------------IWYTRNMIKRLLEEREVLLYCDFHGHSRKNNIFL--YGCNNN 574

  Fly   322 E---------FP----PNFDDMMEVAKAYGDAVESLPYGTVYRYGSAAGILYPASGATIDWAYNE 373
            .         ||    .|..|.... .:....|:....||               |..:.|   .
Human   575 NRKYWLHERVFPLMLCKNAPDKFSF-HSCNFKVQKCKEGT---------------GRVVMW---R 620

  Fly   374 QGVEISYTIEF----------RDTGRYGFILPPVHIIPNAEEALIGIAALLEKCKDLGY 422
            .|:..|||:|.          |||          |.             .:|..|.|||
Human   621 MGILNSYTMESTFGGSTLGNKRDT----------HF-------------TIEDLKSLGY 656

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7025NP_609133.2 Propep_M14 36..103 CDD:280416 14/77 (18%)
M14_CP_A-B_like 123..416 CDD:199844 67/376 (18%)
AGBL2NP_079059.2 GVQW 105..>120 CDD:290611
M14_AGBL2-3_like 407..666 CDD:133117 65/333 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 746..770
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 796..879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.