DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7025 and Agbl3

DIOPT Version :9

Sequence 1:NP_609133.2 Gene:CG7025 / 34042 FlyBaseID:FBgn0031930 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001276585.1 Gene:Agbl3 / 76223 MGIID:1923473 Length:1006 Species:Mus musculus


Alignment Length:367 Identity:70/367 - (19%)
Similarity:121/367 - (32%) Gaps:141/367 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DNYSVYKVKFETQAQRSILRKLAEDRENFRLWHEAKDELHLMLSPGAFGELETE---IQKTNVTA 91
            ||..|::.:||:...:.:::             .|..|..|.:.|..|....|:   .|.||..|
Mouse   171 DNTLVFEARFESGNLQKVVK-------------VADHEYELTVRPDLFTNKHTQWYYFQVTNTQA 222

  Fly    92 E---------------LFISNVQELIDSEEAA-------------------NLKASRDG----TF 118
            |               |:...::.|..||:.|                   ||  .:||    :.
Mouse   223 EIVYRFTIVNFTKPASLYNRGMKPLFYSEKEAKTHNIGWQRIGDQIKYYKNNL--GQDGRHFFSL 285

  Fly   119 GWT------------------KYNSLAEIYAWLDD---------ILAAYPTITESFIVGQSYEGR 156
            .||                  .|::|.|..:.::.         |.....|:..:.:    |...
Mouse   286 TWTFQFPHSQDTCYFAHCYPYTYSNLQEYLSGINSDPVRSKFCKIRVLCHTLARNMV----YVLT 346

  Fly   157 TIRGIKISYKSNNPGVLIESNIHAREWITSATATWLINEFL------TSTDELVRDLAENHDWYI 215
            ....:|.| .|....|::.:.:|..|    ..::|::..||      :|...|:||   ...:.:
Mouse   347 ITTPLKTS-DSKRKAVILTARVHPGE----TNSSWIMKGFLDYILGDSSDARLLRD---TFIFKV 403

  Fly   216 VPVLNVDGFVYTHEKDRMWRKTRQPSEISSCIGADPNRNYDSHWMENEGASSNPCAEDYGGPKPF 280
            ||:||.||.:..:.:             .|..|.|.||||.|...|                   
Mouse   404 VPMLNPDGVIVGNYR-------------CSLAGRDLNRNYTSLLKE------------------- 436

  Fly   281 SEPEIQAMSEFVISIKDKINVLLAFHSYSQLLLSPYGHTKEE 322
            |.|.:......:..:.:|..|:|    |..|    :||::::
Mouse   437 SFPSVWYTRNMINRLMEKREVIL----YCDL----HGHSRKQ 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7025NP_609133.2 Propep_M14 36..103 CDD:280416 15/84 (18%)
M14_CP_A-B_like 123..416 CDD:199844 43/215 (20%)
Agbl3NP_001276585.1 M14_AGBL2-3_like 315..576 CDD:133117 40/208 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 790..810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.