DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7025 and Agtpbp1

DIOPT Version :9

Sequence 1:NP_609133.2 Gene:CG7025 / 34042 FlyBaseID:FBgn0031930 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001364026.1 Gene:Agtpbp1 / 67269 MGIID:2159437 Length:1218 Species:Mus musculus


Alignment Length:253 Identity:55/253 - (21%)
Similarity:95/253 - (37%) Gaps:82/253 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 PGVLIESNIHAREWITSATATWLIN---EFLTSTDELVRDLAENHDWYIVPVLNVDGFVYTHEKD 231
            |.:.:.:.:|..|    ..|:|::.   |:|.|.....:.|.|::.:.|||:||.||.:..:.: 
Mouse   903 PYIFLSARVHPGE----TNASWVMKGTLEYLMSNSPTAQSLRESYIFKIVPMLNPDGVINGNHR- 962

  Fly   232 RMWRKTRQPSEISSCIGADPNRNYDSHWMENEGASSNPCAEDYGGPKPFSEPEI---QAMSEFVI 293
                        .|..|.|.||.:.|                   |.|...|.|   :.:.:::.
Mouse   963 ------------CSLSGEDLNRQWQS-------------------PNPELHPTIYHAKGLLQYLA 996

  Fly   294 SIKDKINVLLAFHSYSQLL-LSPYG--------HTKEEFPPNFDDMMEVAKAYGDAVESLPYGTV 349
            ::|....|...:|.:|:.. :..||        ||.:.            .|..|.||.:.|.|:
Mouse   997 AVKRLPLVYCDYHGHSRKKNVFMYGCSIKETVWHTHDN------------SASCDIVEDMGYRTL 1049

  Fly   350 ----------YRYGSAAGILYPASGAT---IDWAYNEQGVEISYTIEFR----DTGRY 390
                      :...|.:.::..:..:|   :.|  .|.||:.|||:|..    |.|||
Mouse  1050 PKILSHIAPAFCMSSCSFVVEKSKESTARVVVW--REIGVQRSYTMESTLCGCDQGRY 1105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7025NP_609133.2 Propep_M14 36..103 CDD:280416
M14_CP_A-B_like 123..416 CDD:199844 55/253 (22%)
Agtpbp1NP_001364026.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 476..512
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 590..617
Pepdidase_M14_N 704..838 CDD:407865
M14_Nna1 861..1131 CDD:349477 55/253 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1193..1218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.