DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7025 and agbl2

DIOPT Version :9

Sequence 1:NP_609133.2 Gene:CG7025 / 34042 FlyBaseID:FBgn0031930 Length:429 Species:Drosophila melanogaster
Sequence 2:XP_017209580.1 Gene:agbl2 / 568152 ZFINID:ZDB-GENE-070719-6 Length:1025 Species:Danio rerio


Alignment Length:235 Identity:50/235 - (21%)
Similarity:88/235 - (37%) Gaps:82/235 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 TAELFISNVQELIDSEEAANLKA-----------------SRDG----TFGWT---KYNS----L 126
            ::.|:.:.:..|:.||:.|.||.                 .:||    :..||   .|:.    |
Zfish   266 SSSLYGAGMCPLLYSEKTAWLKGEGWKRTGSSIRYYRNNIEQDGKALYSLTWTLEFPYDGDTCYL 330

  Fly   127 AEIYAWL-------------DDILAAYPTITESFIVGQSYEGRTIRGIKISYKSNN-------PG 171
            |..|.:.             |.:.|||..:.   ::.:|..|..:..:.|:..|::       ..
Zfish   331 AHCYPYTYSKLQHYLREVISDPVRAAYCKLR---VLCRSLAGNAVYVLTITAPSSSLAERKAKRA 392

  Fly   172 VLIESNIHAREWITSATATWLINEFLTSTDELVRDLAENH------DWYIVPVLNVDGFVYTHEK 230
            |::.:.:|..|    ...:|::..||   :.|:.||.:.|      .:.::|:||.||.|..:.:
Zfish   393 VVVTARVHPGE----TNGSWMMQGFL---EFLLSDLPDAHLLRETFIFKVIPMLNPDGVVVGNYR 450

  Fly   231 DRMWRKTRQPSEISSCIGADPNRNYDSHWMENEGASSNPC 270
                         .|..|.|.||||.|...:     |.||
Zfish   451 -------------CSLAGRDLNRNYRSMLRD-----SFPC 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7025NP_609133.2 Propep_M14 36..103 CDD:280416 2/12 (17%)
M14_CP_A-B_like 123..416 CDD:199844 39/178 (22%)
agbl2XP_017209580.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.