DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7025 and AGBL3

DIOPT Version :9

Sequence 1:NP_609133.2 Gene:CG7025 / 34042 FlyBaseID:FBgn0031930 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_848658.3 Gene:AGBL3 / 340351 HGNCID:27981 Length:920 Species:Homo sapiens


Alignment Length:365 Identity:69/365 - (18%)
Similarity:121/365 - (33%) Gaps:136/365 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DNYSVYKVKFETQAQRSILRKLAEDRENFRLWHEAKDELHLMLSPGAFGELETE---IQKTNV-- 89
            ||..:::.:||:...:.:: |:||            .|..|.:.|..|....|:   .|.||:  
Human   166 DNTLMFEARFESGNLQKVV-KVAE------------YEYQLTVRPDLFTNKHTQWYYFQVTNMRA 217

  Fly    90 -------------TAELFISNVQELIDSEEAANL-----------------KASRDG----TFGW 120
                         .|.|:...::.|..||:.|..                 ...:||    :..|
Human   218 GIVYRFTIVNFTKPASLYSRGMRPLFYSEKEAKAHHIGWQRIGDQIKYYRNNPGQDGRHYFSLTW 282

  Fly   121 T------------------KYNSLAEIYAWLDD---------ILAAYPTITESFIVGQSYEGRTI 158
            |                  .|.:|.|..:.:::         |.....|:..:.:    |.....
Human   283 TFQFPHNKDTCYFAHCYPYTYTNLQEYLSGINNDPVRSKFCKIRVLCHTLARNMV----YILTIT 343

  Fly   159 RGIKISYKSNNPGVLIESNIHAREWITSATATWLINEFL------TSTDELVRDLAENHDWYIVP 217
            ..:|.|.......|::.:.:|..|    ..::|::..||      :|..:|:||   ...:.:||
Human   344 TPLKNSDSRKRKAVILTARVHPGE----TNSSWIMKGFLDYILGNSSDAQLLRD---TFVFKVVP 401

  Fly   218 VLNVDGFVYTHEKDRMWRKTRQPSEISSCIGADPNRNYDSHWMENEGASSNPCAEDYGGPKPFSE 282
            :||.||.:..:.:             .|..|.|.||||.|...|                   |.
Human   402 MLNPDGVIVGNYR-------------CSLAGRDLNRNYTSLLKE-------------------SF 434

  Fly   283 PEIQAMSEFVISIKDKINVLLAFHSYSQLLLSPYGHTKEE 322
            |.:......|..:.:|..|:|    |..|    :||:::|
Human   435 PSVWYTRNMVHRLMEKREVIL----YCDL----HGHSRKE 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7025NP_609133.2 Propep_M14 36..103 CDD:280416 16/84 (19%)
M14_CP_A-B_like 123..416 CDD:199844 44/215 (20%)
AGBL3NP_848658.3 M14_AGBL2-3_like 310..570 CDD:133117 41/208 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 641..661
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.