DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7025 and CG8945

DIOPT Version :9

Sequence 1:NP_609133.2 Gene:CG7025 / 34042 FlyBaseID:FBgn0031930 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_573190.1 Gene:CG8945 / 32693 FlyBaseID:FBgn0030815 Length:1430 Species:Drosophila melanogaster


Alignment Length:453 Identity:118/453 - (26%)
Similarity:208/453 - (45%) Gaps:65/453 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RLRYDNYSVYKVKFETQAQRSILRKLAEDRENFRL-WHEA---KDELHLMLSPGAFGELETEIQK 86
            |:.||.|.::::|.:.:.|...|.:..:..:..:| |.:.   :....:::.|....:.:..:..
  Fly   978 RISYDKYQIWRLKPQDEEQVRALEEFKKGEDGVKLQWLKGPSLRGLTDVLVPPKMLVDFQGTLNY 1042

  Fly    87 TNVTAELFISNV----------QELIDSEEAANLKASRDGTFGWTKYNSLAEIYAWLDDILAAYP 141
            ..:..|:.|.:|          ::.:.:...:..:.:......|.:|::..||..:|:.:...:|
  Fly  1043 EGIAHEVLIFDVGKAIAYELTKEDYLQTTRPSKPRPTAPPPMTWNRYHNHDEIVKYLETVRMRHP 1107

  Fly   142 TITESFIVGQSYEGRTIRGIKISYK-----SNNPG------------------VLIESNIHAREW 183
            .:.|...:|:|:|||.:..:||..|     :||.|                  |.:|:......|
  Fly  1108 QLVELIHIGRSFEGRPLIVVKIESKQTAAAANNDGLHTIKRPKRKRKSGQANAVFVEAGAQGLAW 1172

  Fly   184 ITSATATWLINEFL-----TSTDELVRDLAENHDWYIVPVLNVDGFVYTHEKDRMWRKTRQ---- 239
            |..|.|||:|.|.|     ..::|.| :...|..|||:||||.||:.|:||.||.|:|:|.    
  Fly  1173 IGPAAATWMIAELLRLMKTNKSNEDV-EFIRNTTWYIMPVLNPDGYAYSHEYDRFWKKSRSQHQT 1236

  Fly   240 --PSEI---------------SSCIGADPNRNYDSHWMENEGASSNPCAEDYGGPKPFSEPEIQA 287
              ||.:               ..|.|.|.:||:..|| ...|:|..||.|.|.||.||||||.:|
  Fly  1237 PPPSGLLDSAMTWLQQKRGPDKVCYGVDLDRNWLYHW-GKRGSSKAPCNEFYAGPAPFSEPETKA 1300

  Fly   288 MSEFVISIKDKINVLLAFHSYSQLLLSPYGHTKEEFPPNFDDMMEVAKAYGDAVESLPYGTVYRY 352
            :|||::..:.:|.:.::..:|.|::..|............||.::||....|.:......:.|:.
  Fly  1301 VSEFLMDYRTQIKLYISLQAYGQVISYPVKANSTFNSERLDDFLDVAMVGTDGLRKKGSKSRYKV 1365

  Fly   353 GSAAGILYPASGATIDWAYNEQGVEISYTIEFRDTGRYGFILPPVHIIPNAEEALIGIAALLE 415
            .::..::...||....:|..|.|:..|||::..|.|.:|::||...|.|.|.:|...|:.:|:
  Fly  1366 DASNDLIEQRSGCADAFAAYEIGIPFSYTLQLADNGVHGYLLPSSAIEPTARDAFEIISGMLD 1428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7025NP_609133.2 Propep_M14 36..103 CDD:280416 9/80 (11%)
M14_CP_A-B_like 123..416 CDD:199844 104/342 (30%)
CG8945NP_573190.1 Propep_M14 988..1058 CDD:280416 9/69 (13%)
M14_CP_A-B_like 1089..1430 CDD:199844 104/342 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.