DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7025 and CG31019

DIOPT Version :9

Sequence 1:NP_609133.2 Gene:CG7025 / 34042 FlyBaseID:FBgn0031930 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_733391.1 Gene:CG31019 / 318558 FlyBaseID:FBgn0051019 Length:659 Species:Drosophila melanogaster


Alignment Length:413 Identity:71/413 - (17%)
Similarity:142/413 - (34%) Gaps:136/413 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QDERLRYDNYSVYK------------VKFETQAQRSILRKLAEDRENFRLWHEAKDELHLMLSPG 75
            ||:|:.:...::.|            ||..::.:...|.|    |:.| .:..|..:.|.:||..
  Fly   101 QDQRVLFHIVNISKSRNLFSSGLTPLVKSSSRPKWQRLSK----RQVF-FYRSAMHQGHYVLSFA 160

  Fly    76 AFGELETEIQKTNVTAELFISNVQ---ELIDSEEAANLKASRDGTFGWTKYNSLAEIYAWLDDIL 137
            ...:.|.::.:..:......|.:|   .:||:.:.::.:.:|                       
  Fly   161 FIFDKEEDVYQFALAWPYSYSRLQSYLNVIDARQGSDKRFTR----------------------- 202

  Fly   138 AAYPTITESFIVGQSYEGR-----TIRGIKISYKSNN-------PGVLIESNIHAREWITSATAT 190
                     .::.:|.:.|     ||..:....:|.|       ..:::....|:.|...|....
  Fly   203 ---------CVLVKSLQNRNVDLLTIDHVTAKQRSTNRLDRSFIRVIVVLCRTHSSEAPASHVCQ 258

  Fly   191 WLINEFLTSTDELVRDLAENHDWYIVPVLNVDGFVYTHEKDRMWRKTRQPSEISSCIGADPNRNY 255
            .|| |||.....:...|.:|..:.|||::|.||....:.:             .:.:|.|.|||:
  Fly   259 GLI-EFLVGNHPIAAVLRDNFVFKIVPMVNPDGVFLGNNR-------------CNLMGQDMNRNW 309

  Fly   256 DSHWMENEGASSNPCAEDYGGPKPFSEPEIQAMSEFVISI----------KDKINVL------LA 304
                  :.|:.             |::||:.|:...:..:          .|.|.::      ::
  Fly   310 ------HIGSE-------------FTQPELHAVKGMLKELDNSDVSRGIETDLIGIIFVCSYNIS 355

  Fly   305 FHSYS-QLLLSPYGHTKEEFPPNFDDMMEVAKAYGDAVESLPYGTVYRYGSAAGILYPASGATID 368
            |.:|. ..::..:.::.          |.....||:.     |..||||  ...:::|..     
  Fly   356 FQTYQIDFVIDLHANSS----------MHGCFIYGNT-----YEDVYRY--ERHLVFPRL----- 398

  Fly   369 WAYNEQGVEISYTIEFRDTGRYG 391
            :|.|.|.....:|:...|..:.|
  Fly   399 FASNAQDYVADHTMFNADERKAG 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7025NP_609133.2 Propep_M14 36..103 CDD:280416 14/81 (17%)
M14_CP_A-B_like 123..416 CDD:199844 51/298 (17%)
CG31019NP_733391.1 M14_AGBL4_like 190..478 CDD:133118 54/319 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.