DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7025 and Cpa6

DIOPT Version :9

Sequence 1:NP_609133.2 Gene:CG7025 / 34042 FlyBaseID:FBgn0031930 Length:429 Species:Drosophila melanogaster
Sequence 2:XP_038965675.1 Gene:Cpa6 / 312913 RGDID:1311764 Length:290 Species:Rattus norvegicus


Alignment Length:285 Identity:111/285 - (38%)
Similarity:168/285 - (58%) Gaps:12/285 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 PTITESFIVGQSYEGRTIRGIKISYKSN--NPGVLIESNIHAREWITSATATWLINEFLTS--TD 201
            |.:...|.:|:|:|||::..|::..||.  ...|.|:..|||||||..|...|.:.|.:.:  ||
  Rat     9 PGLVRVFPIGRSFEGRSLLIIQLGRKSQVYKRAVWIDCGIHAREWIGPAFCQWFVKEAILTYKTD 73

  Fly   202 ELVRDLAENHDWYIVPVLNVDGFVYTHEKDRMWRKTRQPSEISSCIGADPNRNYDSHWMENEGAS 266
            ..:|.:..:..:||:|||||||:.::...||.|||||..:....|.|.|.|||:...|.: ||||
  Rat    74 PAMRKMLNHLYFYIMPVLNVDGYHFSWTHDRFWRKTRSRNSKFHCRGVDANRNWKVKWCD-EGAS 137

  Fly   267 SNPCAEDYGGPKPFSEPEIQAMSEFVISIKDKINVLLAFHSYSQLLLSPYGHTKEEFPPNFDDMM 331
            ::||.:.|.||.|.||||::|::.|:...:.:|...|:||:|:|:||.||.: |....|||..:.
  Rat   138 ADPCDDTYCGPFPESEPEVKAVANFLRKHRKRIRAYLSFHAYAQMLLYPYSY-KHATIPNFSCVE 201

  Fly   332 EVAKAYGDAVESLPYGTVYRYGSAAGILYPASGATIDWAYNEQGVEISYTIEFRDTGRYGFILPP 396
            ..|.....|:.|: :|..||:|.|:..||.:||.::|||| :.|:..|:..|.||||.:||:||.
  Rat   202 FAAHKAVKALRSV-HGIRYRHGPASQTLYVSSGNSMDWAY-KNGIPYSFAFELRDTGYFGFLLPE 264

  Fly   397 VHIIPNAEEALIGI----AALLEKC 417
            :.|.|...|.::.:    ..||:.|
  Rat   265 MLIKPTCTETMLAVKNITMHLLKNC 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7025NP_609133.2 Propep_M14 36..103 CDD:280416
M14_CP_A-B_like 123..416 CDD:199844 110/282 (39%)
Cpa6XP_038965675.1 Peptidase_M14_like 1..289 CDD:416253 110/283 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351700
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 262 1.000 Inparanoid score I3014
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X86
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.