DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7025 and AGTPBP1

DIOPT Version :9

Sequence 1:NP_609133.2 Gene:CG7025 / 34042 FlyBaseID:FBgn0031930 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001273644.1 Gene:AGTPBP1 / 23287 HGNCID:17258 Length:1278 Species:Homo sapiens


Alignment Length:482 Identity:93/482 - (19%)
Similarity:169/482 - (35%) Gaps:174/482 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ERLRYD----NYSVYK----VKFETQAQRSILRKLAEDRENFRLWHEAKDELHLMLS-------- 73
            :|:.||    ||::.:    :||.::.:...|||:.:.|:|         |..|:|:        
Human   742 DRVVYDLDNPNYTIPEEGDILKFNSKFESGNLRKVIQIRKN---------EYDLILNSDINSNHY 797

  Fly    74 ------------PGA---FGELETEIQKT--NVTAELFISNVQELID------------------ 103
                        ||.   |..:..|...:  |...:..:.:|||.::                  
Human   798 HQWFYFEVSGMRPGVAYRFNIINCEKSNSQFNYGMQPLMYSVQEALNARPWWIRMGTDICYYKNH 862

  Fly   104 ----SEEAANLKASRDGTFGWT------------------KYNSL-------------AEIYAWL 133
                |..|...|.....|..:|                  .|::|             .:|| :.
Human   863 FSRSSVAAGGQKGKSYYTITFTVNFPHKDDVCYFAYHYPYTYSTLQMHLQKLESAHNPQQIY-FR 926

  Fly   134 DDILA------AYPTITESFIVGQSYEGRTIRGIKISYKSNNPGVLIESNIHAREWITSATATWL 192
            .|:|.      :.|.:|.:.:...:|...      |.:..|.|.|.:.:.:|..|    ..|:|:
Human   927 KDVLCETLSGNSCPLVTITAMPESNYYEH------ICHFRNRPYVFLSARVHPGE----TNASWV 981

  Fly   193 IN---EFLTSTDELVRDLAENHDWYIVPVLNVDGFVYTHEKDRMWRKTRQPSEISSCIGADPNRN 254
            :.   |:|.|.:...:.|.|::.:.|||:||.||.:..:.:             .|..|.|.||.
Human   982 MKGTLEYLMSNNPTAQSLRESYIFKIVPMLNPDGVINGNHR-------------CSLSGEDLNRQ 1033

  Fly   255 YDSHWMENEGASSNPCAEDYGGPKPFSEPEI---QAMSEFVISIKDKINVLLAFHSYSQLL-LSP 315
            :.|                   |.|...|.|   :.:.:::.::|....|...:|.:|:.. :..
Human  1034 WQS-------------------PSPDLHPTIYHAKGLLQYLAAVKRLPLVYCDYHGHSRKKNVFM 1079

  Fly   316 YGHTKEEFPPNFDDMMEVAKAYGDAVESLPYGTV----------YRYGSAAGILYPASGAT---I 367
            ||.:.:|...:.:|.....    |.||...|.|:          :...|.:.::..:..:|   :
Human  1080 YGCSIKETVWHTNDNATSC----DVVEDTGYRTLPKILSHIAPAFCMSSCSFVVEKSKESTARVV 1140

  Fly   368 DWAYNEQGVEISYTIEFR----DTGRY 390
            .|  .|.||:.|||:|..    |.|:|
Human  1141 VW--REIGVQRSYTMESTLCGCDQGKY 1165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7025NP_609133.2 Propep_M14 36..103 CDD:280416 18/95 (19%)
M14_CP_A-B_like 123..416 CDD:199844 65/311 (21%)
AGTPBP1NP_001273644.1 M14_Nna1 911..1188 CDD:133116 63/304 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.