DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7025 and W01A8.6

DIOPT Version :9

Sequence 1:NP_609133.2 Gene:CG7025 / 34042 FlyBaseID:FBgn0031930 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_492003.2 Gene:W01A8.6 / 189076 WormBaseID:WBGene00012168 Length:380 Species:Caenorhabditis elegans


Alignment Length:331 Identity:101/331 - (30%)
Similarity:162/331 - (48%) Gaps:32/331 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 SRDGTFGWTKYNSLAEIYAWLDDILAAYPTITESFIVGQSYEGRTIRGIKISYKSNNPG-----V 172
            :|...|..|.||...:...::..:....|:..:...:|::.|||.:.|::|. |...||     |
 Worm    25 ARTPFFDLTVYNDWPQFEDYIKGVAHDNPSFVQLKTIGRTREGRPLLGVRIG-KPALPGKRKIAV 88

  Fly   173 LIESNIHAREWITSATATW----LINEFLTSTDELVRDLAENHDWYIVPVLNVDGFVY----THE 229
            .::...|||||.....|.:    |:|.:|  :|:.:....|..|.|:.||||.|||||    |..
 Worm    89 WLDGGNHAREWPAFHVAVYFIEKLVNGYL--SDDKITKYVETLDIYVFPVLNPDGFVYSRTSTRA 151

  Fly   230 KDRMWRKTRQPSEISS---------CIGADPNRNYDSHWMENEGASSNPCAEDYGGPKPFSEPEI 285
            ..|.|||.|.|...:.         |.|.|.|||||..:.......:|||::::.||:||||||.
 Worm   152 MIRQWRKNRAPENCTGTGPFQTDICCEGVDLNRNYDIGFSHKNYPFNNPCSDEFQGPRPFSEPET 216

  Fly   286 QAMSEFVIS--IKDKINVLLAFHSYSQLLLSPYGHTKEEFPPNFDDMMEVAKAYGDAVESLPY-G 347
            :|:.:|::|  |..::..|::.|::.||.:.||.:.|..:|.:..|:..:|....|.|  ..| .
 Worm   217 RAVRDFIMSSEIYGRLYALVSMHTHGQLWILPYNYQKRTYPQDIKDLEILANRAADRV--FAYRE 279

  Fly   348 TVYRYGSAAGILYPASGATIDWAYNEQGVEISYTIEFRDTGR--YGFILPPVHIIPNAEEALIGI 410
            |.||.|:||.:|..|:|...||.......:..|.:|.....:  :.|.:.|..:||..:|..:||
 Worm   280 TKYRVGTAADMLGTATGGATDWIKKNTPTKYVYVLELPPDMKTWFAFQVKPHWLIPIGKETWLGI 344

  Fly   411 AALLEK 416
            ..:.::
 Worm   345 EVIFDQ 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7025NP_609133.2 Propep_M14 36..103 CDD:280416
M14_CP_A-B_like 123..416 CDD:199844 98/319 (31%)
W01A8.6NP_492003.2 Zn_pept 35..337 CDD:214748 95/306 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37541
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47975
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100142
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.