DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7025 and CPA1

DIOPT Version :10

Sequence 1:NP_609133.2 Gene:CG7025 / 34042 FlyBaseID:FBgn0031930 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001859.1 Gene:CPA1 / 1357 HGNCID:2296 Length:419 Species:Homo sapiens


Alignment Length:148 Identity:31/148 - (20%)
Similarity:53/148 - (35%) Gaps:38/148 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 RKL--WNPRNFKAHVSPHEMLQAVVLWSSKQFQITKQGDPIEFLSWFLHSLHKQLRG-----NKQ 280
            |||  ..|||:.::.:......|......||.::.::.:.::.....|.  |..|.|     |..
Human    75 RKLSPTEPRNYGSYSTQASAAAATAELLKKQEELNRKAEELDRRERELQ--HVALGGAGTRQNNW 137

  Fly   281 PDSSVINRSFLGEMKIYTRKLPPTELDDVQKQLLLATDEYQEKVETSTFLYLTCDLPATPLFIDE 345
            |...    ||.        .:.|....|:..::   ..|:|:.|.|..:|:: |...|..|    
Human   138 PPLP----SFC--------PVKPCFFQDISMEI---PQEFQKTVSTMYYLWM-CSTLALLL---- 182

  Fly   346 LRENIIPQVNLYQLLAKF 363
                     |.:..||:|
Human   183 ---------NFFACLARF 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7025NP_609133.2 Propep_M14 35..105 CDD:460505
M14_CP_A-B_like 123..415 CDD:349433 31/148 (21%)
CPA1NP_001859.1 Propep_M14 26..100 CDD:460505 7/24 (29%)
M14_CPA 117..417 CDD:349442 22/106 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.