DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7025 and CPO

DIOPT Version :9

Sequence 1:NP_609133.2 Gene:CG7025 / 34042 FlyBaseID:FBgn0031930 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_775100.1 Gene:CPO / 130749 HGNCID:21011 Length:374 Species:Homo sapiens


Alignment Length:357 Identity:135/357 - (37%)
Similarity:204/357 - (57%) Gaps:27/357 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 DELHL--MLSPGAFGELETEIQKTNVTAELFISNVQELID-SEEAANLKASRDGTFGWTKYNSLA 127
            :.|:|  ||.||..|...:..|           :.||::| |....:|:     |:.:..|:.:.
Human     6 ETLYLLGMLVPGGLGYDRSLAQ-----------HRQEIVDKSVSPWSLE-----TYSYNIYHPMG 54

  Fly   128 EIYAWLDDILAAYPTITESFIVGQSYEGRTIRGIKISYKSNNPGVLI--ESNIHAREWITSATAT 190
            |||.|:.:|...|..:.....:|.:||...:..:|||..|.||..:|  :..|||||||..|...
Human    55 EIYEWMREISEKYKEVVTQHFLGVTYETHPMYYLKISQPSGNPKKIIWMDCGIHAREWIAPAFCQ 119

  Fly   191 WLINEFLTS--TDELVRDLAENHDWYIVPVLNVDGFVYTHEKDRMWRKTRQPSEISSCIGADPNR 253
            |.:.|.|.:  .:..:|.|..|.|:|::||||:||::||...||:|||:|.|....:|.|.|.||
Human   120 WFVKEILQNHKDNSSIRKLLRNLDFYVLPVLNIDGYIYTWTTDRLWRKSRSPHNNGTCFGTDLNR 184

  Fly   254 NYDSHWMENEGASSNPCAEDYGGPKPFSEPEIQAMSEFVISIKDKINVLLAFHSYSQLLLSPYGH 318
            |:::.|. :.|||.|...:.:.|..|.||||.:|::.|:.|.||.|...|..|||.||:|:|||:
Human   185 NFNASWC-SIGASRNCQDQTFCGTGPVSEPETKAVASFIESKKDDILCFLTMHSYGQLILTPYGY 248

  Fly   319 TKEEFPPNFDDMMEVAKAYGDAVESLPYGTVYRYGSAAGILYPASGATIDWAYNEQGVEISYTIE 383
            ||.: ..|..:|::|.:...:|::: .|||.||.||:|.|||.:||::.||| .:.|:..|||.|
Human   249 TKNK-SSNHPEMIQVGQKAANALKA-KYGTNYRVGSSADILYASSGSSRDWA-RDIGIPFSYTFE 310

  Fly   384 FRDTGRYGFILPPVHIIPNAEEALIGIAALLE 415
            .||:|.|||:||...|.|..||.:..:.::|:
Human   311 LRDSGTYGFVLPEAQIQPTCEETMEAVLSVLD 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7025NP_609133.2 Propep_M14 36..103 CDD:280416 10/38 (26%)
M14_CP_A-B_like 123..416 CDD:199844 121/297 (41%)
CPONP_775100.1 M14_CPO 47..344 CDD:133105 121/300 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157732
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 1 1.000 - - mtm8518
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1730
SonicParanoid 1 1.000 - - X86
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.780

Return to query results.
Submit another query.