DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7025 and LOC100489361

DIOPT Version :9

Sequence 1:NP_609133.2 Gene:CG7025 / 34042 FlyBaseID:FBgn0031930 Length:429 Species:Drosophila melanogaster
Sequence 2:XP_017952843.2 Gene:LOC100489361 / 100489361 -ID:- Length:454 Species:Xenopus tropicalis


Alignment Length:429 Identity:137/429 - (31%)
Similarity:230/429 - (53%) Gaps:24/429 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALNSLPIVLALVVLAQGASFGQDERLRYDNYSVYKVKFETQAQRSILRKLAEDRENFRLWH--- 62
            |.|.:|...|..:::.:|...    :::||...|.|:..:|......::.|.:: ....||.   
 Frog     1 MKLFNLWFCLLGILVYEGFCM----KVKYDGDQVLKMIPQTLKHAQFMQGLIQE-WMLDLWKPVM 60

  Fly    63 ----EAKDELHLMLSPGAFGELETEIQKTNVTAELFISNVQELIDSE---EAANLKASRDGTFGW 120
                :|..|:|:.:......|::.::.:..:..::.||:||||::..   |....|.|.| .:.:
 Frog    61 VEQIQAGREMHVRVPFSHLQEIKEKLLQNMLPYQILISDVQELVNRNTPIETKMQKISLD-NYDY 124

  Fly   121 TKYNSLAEIYAWLDDILAAYPTITESFIVGQSYEGRTIRGIKISYKSNNPG--VLIESNIHAREW 183
            |||:.:.|||.|::.|...:..:.....:|.:||.|.|...||.:.|:.|.  :.::..||||||
 Frog   125 TKYHPMDEIYDWMEQIQLKHRDLVTKHFMGSTYELRPIYYFKIGWPSDKPKKIIFMDCGIHAREW 189

  Fly   184 ITSATATWLINEFLT--STDELVRDLAENHDWYIVPVLNVDGFVYTHEKDRMWRKTRQPSEISSC 246
            |..|...|.:.|.|:  |.::|:.::.:..|:|:|||.|:||::|:...:|:|||.|.|...::|
 Frog   190 IAVAYCQWFVKEILSSHSNNKLLTNVLKQVDFYVVPVFNIDGYIYSWTTERLWRKNRSPHNNATC 254

  Fly   247 IGADPNRNYDSHWMENEGASSNPCAEDYGGPKPFSEPEIQAMSEFVISIKDKINVLLAFHSYSQL 311
            .|.|.|||::|.|. :.|||.:..::.:.|..|.||||.||::..:...|.:|...|..|||.|.
 Frog   255 YGVDLNRNFNSSWC-SVGASRDCNSQTFCGSAPASEPETQAVANLMERTKSQILFYLTIHSYGQY 318

  Fly   312 LLSPYGHTKEEFPPNFDDMMEVAKAYGDAVESLPYGTVYRYGSAAGILYPASGATIDWAYNEQGV 376
            :|.|||.|... ..|..:|.:||:|....::. .:..||..||::.:||..||::.||| .:.|:
 Frog   319 ILLPYGSTTNP-SVNHVEMTKVAEAAAAKMKE-KHNIVYTVGSSSVVLYENSGSSCDWA-GDIGI 380

  Fly   377 EISYTIEFRDTGRYGFILPPVHIIPNAEEALIGIAALLE 415
            :.|||.|.||.|.|||.||...|.|..||.:..:.:::|
 Frog   381 KFSYTFELRDNGTYGFQLPAELIKPTCEETMTAVISMME 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7025NP_609133.2 Propep_M14 36..103 CDD:280416 15/73 (21%)
M14_CP_A-B_like 123..416 CDD:199844 108/297 (36%)
LOC100489361XP_017952843.2 Propep_M14 36..106 CDD:396700 14/70 (20%)
Peptidase_M14_like 124..420 CDD:416253 110/300 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1730
SonicParanoid 1 1.000 - - X86
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.