DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7025 and cpo

DIOPT Version :9

Sequence 1:NP_609133.2 Gene:CG7025 / 34042 FlyBaseID:FBgn0031930 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001139101.1 Gene:cpo / 100005630 ZFINID:ZDB-GENE-070619-6 Length:363 Species:Danio rerio


Alignment Length:313 Identity:120/313 - (38%)
Similarity:185/313 - (59%) Gaps:11/313 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 TFGWTKYNSLAEIYAWLDDILAAYPTITESFIVGQSYEGRTIRGIKISYKSNNP--GVLIESNIH 179
            ::.:|||:::.||.||::.:....|.:..:...||:||.|.|..:||.:.|..|  .:.::..||
Zfish    29 SYDYTKYHTMDEISAWMNQMQRENPDVVSTMTYGQTYEKRNITLLKIGFSSTTPKKAIWMDCGIH 93

  Fly   180 AREWITSATATWLINEFLTS--TDELVRDLAENHDWYIVPVLNVDGFVYT--HEKDRMWRKTRQP 240
            |||||..|.....:.|.|.|  ||..|..|.:|.|:||.||||:||::|:  :...|:|||:|.|
Zfish    94 AREWIAPAFCQHFVKEVLGSYKTDSRVNMLFKNLDFYITPVLNMDGYIYSWLNNSTRLWRKSRSP 158

  Fly   241 -SEISSCIGADPNRNYDSHWMENEGASSNPCAEDYGGPKPFSEPEIQAMSEFVISIKDKINVLLA 304
             .|.|:|.|.|.|||:.::| ...|.|.|.|:|.|.|....||||.:|:::|:.:.::.:...|.
Zfish   159 CHENSTCSGTDLNRNFYANW-GMVGISRNCCSEVYNGATALSEPEAEAVTDFLGAHQNHLLCYLT 222

  Fly   305 FHSYSQLLLSPYGHTKEEFPPNFDDMMEVAKAYGDAVESLPYGTVYRYGSAAGILYPASGATIDW 369
            .|||.||:|.||||.... .||:|::|||..|...|:::: :|..|:.||:..:|||.||::.|:
Zfish   223 IHSYGQLILVPYGHPNIS-APNYDELMEVGLAAAKAIKAV-HGKSYKVGSSPDVLYPNSGSSRDF 285

  Fly   370 AYNEQGVEISYTIEFRDTGRYGFILPPVHIIPNAEEALIGIAALLEKCKDLGY 422
            | ...|:..|:|.|.||.|::|||||...|.|..:||..|..:::....|..:
Zfish   286 A-RLIGIPYSFTFELRDEGQHGFILPEDQIQPTCQEAYEGAMSIINYVHDKNF 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7025NP_609133.2 Propep_M14 36..103 CDD:280416
M14_CP_A-B_like 123..416 CDD:199844 117/299 (39%)
cpoNP_001139101.1 M14_CP_A-B_like 35..332 CDD:199844 117/300 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593507
Domainoid 1 1.000 251 1.000 Domainoid score I2056
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1730
SonicParanoid 1 1.000 - - X86
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.