DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18585 and cpb1

DIOPT Version :9

Sequence 1:NP_001260213.1 Gene:CG18585 / 34041 FlyBaseID:FBgn0031929 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_031758320.1 Gene:cpb1 / 496994 XenbaseID:XB-GENE-853710 Length:414 Species:Xenopus tropicalis


Alignment Length:416 Identity:137/416 - (32%)
Similarity:222/416 - (53%) Gaps:24/416 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWLLATLVALTSAGILKDSPKERYDNFRVYKLTIQNKIQLAAIEKIGELTKKYNIW----KEYDE 64
            :|.|..||:|.:.    .:....:...:|:::..||...:..|:.:.: |:..:.|    .:..|
 Frog     1 MWALLLLVSLAAV----SAEPRNFHGEKVFRVIPQNAEHVELIKSMAQ-TEGLDFWLPDSAQLVE 60

  Fly    65 RSRQIDIMVSPGELNHFQELLKFNNISSELMIENVQERIDEEQVTPTADS---ATFGWTKYYELE 126
            :.::.|...........|.||:.:.:..|::|.::|:.:::::     ||   |...:.||.:|:
 Frog    61 QGKRADFHADGHVSYEVQALLQQSGMPYEILINDLQDALEKQR-----DSNIRAVHSYEKYNDLD 120

  Fly   127 EIEAWLDEILNAYPSVTEEFIVGKSYEGRTIRGIKISHKAGN-PGIFIESNIHAREWITSASATW 190
            .|.||...|....|.:.....:|.||:||.|..:|:.....| ..:||:...||||||:.|...|
 Frog   121 TINAWSANIAAQNPGLVSRSSIGTSYQGRPIYLLKVGKSGANKKAVFIDCGFHAREWISPAFCQW 185

  Fly   191 FINQLLTS--EDADVRSLADNYDWHIIPVFNVDGFEYSHKKDRMWRKTRQPHATNACIGADANRN 253
            |:.:.:::  .:::..||.||.|.:::||.||||:.|:...:|||||||..:..:.|||.|.|||
 Frog   186 FVKEAVSAYGVESEFTSLLDNLDIYVLPVLNVDGYVYTWTTNRMWRKTRSANPNSTCIGTDPNRN 250

  Fly   254 FDSYWLQNNGASDNPCSETFAGDNPESEPEAKALVEYLTKIQDQISVYISFHSYGQYLLSPYGHT 318
            |::.|. ..|||...|.||:.|..||||||.|||..::......|..|::.|||.|.||.||.: 
 Frog   251 FNAGWC-TAGASTRACDETYCGSAPESEPETKALANFIRANIPAIKGYLTIHSYSQMLLFPYSY- 313

  Fly   319 NEEFPENYNDILTIGKAFADAIEALPYGTVYQYGSTADVLYVATGTSVDWVFNELGKKIGYTIEY 383
            :....:::|::..:.:...:::.:| |.|.|.||.....:|:|.|.|.||.: :.|.|..||.|.
 Frog   314 SYAVAKDHNELNAVAQGAVNSLTSL-YKTKYTYGPGGSTIYLAAGGSDDWAY-DAGVKFSYTFEL 376

  Fly   384 RDKGRYGFILPPVQIIPNCEELMVGM 409
            ||.|||||.||..||.|.|||.|:.:
 Frog   377 RDTGRYGFALPESQIKPTCEETMLAV 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18585NP_001260213.1 Propep_M14 34..105 CDD:280416 13/74 (18%)
M14_CP_A-B_like 122..415 CDD:199844 114/291 (39%)
cpb1XP_031758320.1 Propep_M14 31..102 CDD:396700 13/71 (18%)
M14_CPB 111..410 CDD:349443 115/296 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 1 1.000 - - mtm9413
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X86
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.