DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18585 and Agtpbp1

DIOPT Version :9

Sequence 1:NP_001260213.1 Gene:CG18585 / 34041 FlyBaseID:FBgn0031929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001099570.1 Gene:Agtpbp1 / 290986 RGDID:1306307 Length:1219 Species:Rattus norvegicus


Alignment Length:334 Identity:75/334 - (22%)
Similarity:116/334 - (34%) Gaps:121/334 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 NAYPSVTEEFIVGKSY-----EGRTIRGIKISHKAGNPGIFIESNIHAREWITSASATWFIN--- 193
            |:.|.||...:...||     :.||           .|.||:.:.:|..|    .:|:|.:.   
  Rat   878 NSCPLVTITAMPESSYYEHICQFRT-----------RPYIFLSARVHPGE----TNASWVMKGTL 927

  Fly   194 QLLTSEDADVRSLADNYDWHIIPVFNVDG-FEYSHKKDRMWRKTRQPHATNAC--IGADANRNFD 255
            :.|.|.....:||.:.|.:.|:|:.|.|| ...:|:                |  .|.|.||.:.
  Rat   928 EYLMSNSPTAQSLREAYIFKIVPMLNPDGVINGNHR----------------CSLSGEDLNRQWQ 976

  Fly   256 SYWLQNNGASDNPCSETFAGDNPESEP---EAKALVEYLTKIQDQISVYISFHS---------YG 308
            |                   .|||..|   .||.|::||..::....||..:|.         ||
  Rat   977 S-------------------PNPELHPTIYHAKGLLQYLAAVKRLPLVYCDYHGHSRKKNVFMYG 1022

  Fly   309 QYLLSPYGHTNEEFPENYNDILTIGKAFADAIEALPYGTVYQY---------------------G 352
            ..:.....||::            ..|..|.:|.:.|.|:.:.                     .
  Rat  1023 CSIKETVWHTHD------------NAASCDVVEDMGYRTLPKILSHIAPAFCMSSCSFVVEKSKE 1075

  Fly   353 STADVLYVATGTSVDWVFNELGKKIGYTIEYR----DKGRY-GFILPPVQIIPNCEELMVGMLAL 412
            |||.|:          |:.|:|.:..||:|..    |:||| |..:...::.....:..||:|.|
  Rat  1076 STARVV----------VWREIGVQRSYTMESTLCGCDQGRYKGLQIGTRELEEMGAKFCVGLLRL 1130

  Fly   413 IEKTKELGY 421
            ...|..|.|
  Rat  1131 KRLTSPLEY 1139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18585NP_001260213.1 Propep_M14 34..105 CDD:280416
M14_CP_A-B_like 122..415 CDD:199844 72/326 (22%)
Agtpbp1NP_001099570.1 Pepdidase_M14_N 705..839 CDD:407865
M14_Nna1 862..1132 CDD:349477 72/325 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.