DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18585 and oxy-5

DIOPT Version :9

Sequence 1:NP_001260213.1 Gene:CG18585 / 34041 FlyBaseID:FBgn0031929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001293404.1 Gene:oxy-5 / 24104659 WormBaseID:WBGene00045483 Length:162 Species:Caenorhabditis elegans


Alignment Length:82 Identity:19/82 - (23%)
Similarity:35/82 - (42%) Gaps:8/82 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 WLDEILNAYPSVTEEFIVGKSYEGRT--IRGIKISHKAGNPGIFIESNIHAREWITSAS----AT 189
            |...:.:.:.|:.....|.||.|.:.  ::..|:|:  .||...|:..:|:...:.:||    ..
 Worm    14 WAARLQSLFESIFGGKSVTKSIENQAQILKTPKVSN--SNPSAPIKREMHSSSVLKAASFRKPMI 76

  Fly   190 WFINQLLTSEDADVRSL 206
            .|:...|.....|.:||
 Worm    77 KFVGARLPRPFFDAKSL 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18585NP_001260213.1 Propep_M14 34..105 CDD:280416
M14_CP_A-B_like 122..415 CDD:199844 19/82 (23%)
oxy-5NP_001293404.1 DUF2638 75..157 CDD:287852 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.