DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18585 and AGTPBP1

DIOPT Version :9

Sequence 1:NP_001260213.1 Gene:CG18585 / 34041 FlyBaseID:FBgn0031929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001273644.1 Gene:AGTPBP1 / 23287 HGNCID:17258 Length:1278 Species:Homo sapiens


Alignment Length:509 Identity:96/509 - (18%)
Similarity:164/509 - (32%) Gaps:194/509 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LTIQNKIQLAAIEKIGELTKKYNIWKEYDERSRQIDIMVSPGELNHFQE-------------LLK 86
            |...:|.:...:.|:.::.|     .|||.      |:.|....||:.:             ..:
Human   762 LKFNSKFESGNLRKVIQIRK-----NEYDL------ILNSDINSNHYHQWFYFEVSGMRPGVAYR 815

  Fly    87 FNNISSEL-----------MIENVQERIDEE---------------------------------Q 107
            ||.|:.|.           ::.:|||.::..                                 .
Human   816 FNIINCEKSNSQFNYGMQPLMYSVQEALNARPWWIRMGTDICYYKNHFSRSSVAAGGQKGKSYYT 880

  Fly   108 VTPTA------DSATFGWTKYYELEEIEAWLDEILNAY--------PSVTEEFIVGKSYEGRTIR 158
            :|.|.      |...|.:...|....::..|.::.:|:        ..|..|.:.|.|....||.
Human   881 ITFTVNFPHKDDVCYFAYHYPYTYSTLQMHLQKLESAHNPQQIYFRKDVLCETLSGNSCPLVTIT 945

  Fly   159 GI-------KISHKAGNPGIFIESNIHAREWITSASATWFIN---QLLTSEDADVRSLADNYDWH 213
            .:       .|.|....|.:|:.:.:|..|    .:|:|.:.   :.|.|.:...:||.::|.:.
Human   946 AMPESNYYEHICHFRNRPYVFLSARVHPGE----TNASWVMKGTLEYLMSNNPTAQSLRESYIFK 1006

  Fly   214 IIPVFNVDG-FEYSHKKDRMWRKTRQPHATNAC--IGADANRNFDSYWLQNNGASDNPCSETFAG 275
            |:|:.|.|| ...:|:                |  .|.|.||.:.|                   
Human  1007 IVPMLNPDGVINGNHR----------------CSLSGEDLNRQWQS------------------- 1036

  Fly   276 DNPESEP---EAKALVEYLTKIQDQISVYISFHS---------YGQYLLSPYGHTNEEFPENYND 328
            .:|:..|   .||.|::||..::....||..:|.         ||..:.....|||:        
Human  1037 PSPDLHPTIYHAKGLLQYLAAVKRLPLVYCDYHGHSRKKNVFMYGCSIKETVWHTND-------- 1093

  Fly   329 ILTIGKAFADAIEALPYGTVYQY---------------------GSTADVLYVATGTSVDWVFNE 372
                .....|.:|...|.|:.:.                     .|||.|:          |:.|
Human  1094 ----NATSCDVVEDTGYRTLPKILSHIAPAFCMSSCSFVVEKSKESTARVV----------VWRE 1144

  Fly   373 LGKKIGYTIEYR----DKGRY-GFILPPVQIIPNCEELMVGMLALIEKTKELGY 421
            :|.:..||:|..    |:|:| |..:...::.....:..||:|.|...|..|.|
Human  1145 IGVQRSYTMESTLCGCDQGKYKGLQIGTRELEEMGAKFCVGLLRLKRLTSPLEY 1198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18585NP_001260213.1 Propep_M14 34..105 CDD:280416 18/93 (19%)
M14_CP_A-B_like 122..415 CDD:199844 71/351 (20%)
AGTPBP1NP_001273644.1 M14_Nna1 911..1188 CDD:133116 68/337 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.