DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18585 and CPO

DIOPT Version :9

Sequence 1:NP_001260213.1 Gene:CG18585 / 34041 FlyBaseID:FBgn0031929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_775100.1 Gene:CPO / 130749 HGNCID:21011 Length:374 Species:Homo sapiens


Alignment Length:347 Identity:131/347 - (37%)
Similarity:209/347 - (60%) Gaps:21/347 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 MVSPGELNHFQELLKFNNISSELMIENVQERIDEEQVTPTADSATFGWTKYYELEEIEAWLDEIL 136
            |:.||.|.:.:.|           .::.||.:| :.|:|.: ..|:.:..|:.:.||..|:.||.
Human    13 MLVPGGLGYDRSL-----------AQHRQEIVD-KSVSPWS-LETYSYNIYHPMGEIYEWMREIS 64

  Fly   137 NAYPSVTEEFIVGKSYEGRTIRGIKISHKAGNPG--IFIESNIHAREWITSASATWFINQLLTS- 198
            ..|..|..:..:|.:||...:..:|||..:|||.  |:::..|||||||..|...||:.::|.: 
Human    65 EKYKEVVTQHFLGVTYETHPMYYLKISQPSGNPKKIIWMDCGIHAREWIAPAFCQWFVKEILQNH 129

  Fly   199 -EDADVRSLADNYDWHIIPVFNVDGFEYSHKKDRMWRKTRQPHATNACIGADANRNFDSYWLQNN 262
             :::.:|.|..|.|::::||.|:||:.|:...||:|||:|.||....|.|.|.||||::.|. :.
Human   130 KDNSSIRKLLRNLDFYVLPVLNIDGYIYTWTTDRLWRKSRSPHNNGTCFGTDLNRNFNASWC-SI 193

  Fly   263 GASDNPCSETFAGDNPESEPEAKALVEYLTKIQDQISVYISFHSYGQYLLSPYGHTNEEFPENYN 327
            |||.|...:||.|..|.||||.||:..::...:|.|..:::.|||||.:|:|||:|..: ..|:.
Human   194 GASRNCQDQTFCGTGPVSEPETKAVASFIESKKDDILCFLTMHSYGQLILTPYGYTKNK-SSNHP 257

  Fly   328 DILTIGKAFADAIEALPYGTVYQYGSTADVLYVATGTSVDWVFNELGKKIGYTIEYRDKGRYGFI 392
            :::.:|:..|:|::| .|||.|:.||:||:||.::|:|.||. .::|....||.|.||.|.|||:
Human   258 EMIQVGQKAANALKA-KYGTNYRVGSSADILYASSGSSRDWA-RDIGIPFSYTFELRDSGTYGFV 320

  Fly   393 LPPVQIIPNCEELMVGMLALIE 414
            ||..||.|.|||.|..:|::::
Human   321 LPEAQIQPTCEETMEAVLSVLD 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18585NP_001260213.1 Propep_M14 34..105 CDD:280416 7/32 (22%)
M14_CP_A-B_like 122..415 CDD:199844 120/297 (40%)
CPONP_775100.1 M14_CPO 47..344 CDD:133105 120/300 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157731
Domainoid 1 1.000 240 1.000 Domainoid score I2257
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 1 1.000 - - mtm8518
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1730
SonicParanoid 1 1.000 - - X86
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.