DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18585 and cpa3

DIOPT Version :9

Sequence 1:NP_001260213.1 Gene:CG18585 / 34041 FlyBaseID:FBgn0031929 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_031758725.1 Gene:cpa3 / 100494117 XenbaseID:XB-GENE-853724 Length:418 Species:Xenopus tropicalis


Alignment Length:421 Identity:147/421 - (34%)
Similarity:230/421 - (54%) Gaps:31/421 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLWLLATLVALTSAGILKDSPKERYDNFRVYKLTIQNKIQLAAIEKIGELTKKYNIWKEYDERSR 67
            |:|:|.:..:...|       |:.:...:|::..:|.:..:|.|.||.|.. |.:.|.. |...|
 Frog     9 LIWVLGSAASAVLA-------KQTFHGDKVFRAKLQTEGHVALIHKIKEAI-KLDFWHP-DTADR 64

  Fly    68 QI-----DIMVSPGELNHFQELLKFNNISSELMIENVQERIDEEQVTPTADSATFGWTKYYELEE 127
            .:     |..|...:.:..|.||:.|::..|::..::||.| |.|:..|..|....:|||...|:
 Frog    65 MVPHTEADFHVHSDQADSVQILLQQNSVPYEVLFHDLQEGI-EAQLNNTKKSKRHSYTKYNTWEK 128

  Fly   128 IEAWLDEILNAYPSVTEEFIVGKSYEGRTIRGIKISHKAGNP-----GIFIESNIHAREWITSAS 187
            |..|..::...||::.:...:|||.|||.:..:::    |||     .||::..|||||||:.|.
 Frog   129 IVEWTSKLTKKYPNLVQRIDIGKSVEGRPMYVLQV----GNPDSATKAIFMDCGIHAREWISPAF 189

  Fly   188 ATWFINQLLTSEDADVRSLADNYDWHIIPVFNVDGFEYSHKKDRMWRKTRQPHATNACIGADANR 252
            ..||:.:|:..:: ::|.|..:..::|:||||:||:.::..:||||||.|.|.....|:|.|.||
 Frog   190 CQWFVKELIKGKN-NIRELVKSLTFYILPVFNIDGYVWTWTEDRMWRKNRSPSEDAKCVGTDLNR 253

  Fly   253 NFDSYWLQNNGASDNPCSETFAGDNPESEPEAKALVEYLTKIQDQISVYISFHSYGQYLLSPYGH 317
            ||:..|. :.|:||.||||.:.|...|||.|.|.:..::....|.|..||||||:.|.||.|:.:
 Frog   254 NFNISWC-DIGSSDEPCSEIYCGAAAESEIETKNVASFIRSHVDSIKAYISFHSFSQMLLFPFSY 317

  Fly   318 TNEEFPENYNDILTIGKAFADAIEALPYGTVYQYGSTADVLYVATGTSVDWVFNELGKKIGYTIE 382
            |.|..|: :.::..|.|.....::.| |||.|.||.:|..:|...|:|.||.:: ||.|..:|.|
 Frog   318 TYELAPD-HKELDEIAKGAVAELQGL-YGTSYTYGPSASTIYPTAGSSDDWAYS-LGIKYSFTFE 379

  Fly   383 YRDKGRYGFILPPVQIIPNCEE--LMVGMLA 411
            .||:|:.||:||..||...|:|  |.|..:|
 Frog   380 LRDEGKKGFLLPQSQIKATCQETTLAVAYIA 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18585NP_001260213.1 Propep_M14 34..105 CDD:280416 20/75 (27%)
M14_CP_A-B_like 122..415 CDD:199844 115/297 (39%)
cpa3XP_031758725.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 1 1.000 - - mtm9413
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X86
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.