DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slob and Snx16

DIOPT Version :9

Sequence 1:NP_001260212.1 Gene:Slob / 34038 FlyBaseID:FBgn0264087 Length:1347 Species:Drosophila melanogaster
Sequence 2:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster


Alignment Length:514 Identity:97/514 - (18%)
Similarity:167/514 - (32%) Gaps:170/514 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 HNSHHNPQTPKSVSILVYKTLNTVFKSSRKIIVR----VCEVASAKKSFTMFKFNKAAQQQRIDN 138
            :|::|.....::....::|..:|...|.:|.:::    ||.:                 .:|...
  Fly    17 NNNNHLAAPARTSQATLFKKASTAITSPKKSLLKTGNSVCGL-----------------DKRSQF 64

  Fly   139 RNSAVTGHDPFVRPPVPEKKVRNIMKKLHKANGLKRSNSAIEFDVSALTAANRRQIYSRPNIKYQ 203
            |...:.|......|     .:|.|.|  ::.|.|.||.|  |.|||.:.|:|.....:..|.|.:
  Fly    65 REQKLLGRKCHSSP-----DLRQIGK--YQNNSLLRSKS--EGDVSLILASNSGAPLTVANAKSE 120

  Fly   204 YSALDSGNGIVERSPRERAQREKALNAT---QEWIQGANGRY-------------------EVIA 246
            .......:...|:|||....:.:.|...   ::..|.:.|..                   |...
  Fly   121 VCLQRISSHSYEQSPRTPINKSEMLGGARSHRDLTQSSYGNQAGGHSVDLESRSRTPRRMSECSL 185

  Fly   247 HLDEIGSRH-GKNWFLVTDASVRTDRLQTLLPLPPDCVAFEDLPPNECAREILMELLGSLHHPYI 310
            ...:..||| |.|....:..::.:..:     :||       :.||...|   :.::|       
  Fly   186 GYSQSSSRHTGSNSMFASQMTLSSGSV-----VPP-------VDPNAVLR---VPIIG------- 228

  Fly   311 YPVLDLGFLRNSSYNYACLVTPFNSRGSLKDLIYKAQWNEPW--ARKYTRKPNGLPVSQVQRLGR 373
            |.|:: ...|.::|               |..:...:.|:.|  .|:||         ...||..
  Fly   229 YEVME-ERARFTAY---------------KLRVENPETNDYWLVMRRYT---------DFVRLNS 268

  Fly   374 QILEALLFLKERGFPLHGHLHSGNVILQNGAARLSG-------LENGLLGLSSRINAVMWSRSVT 431
            ::.:|        ||        |:.|.....:|.|       |:|.:.||...:|:||....:.
  Fly   269 KLKQA--------FP--------NLTLMLPRKKLFGDNFNAVFLDNRVQGLQIFVNSVMAKEELR 317

  Fly   432 EIENV-DIVCFGHLLYEMCTGQELTTPKPSMRVLEMELQHYPQIGQILEILGLIFEPPSGVCPSV 495
            :.:.| :..|                           |...|...:.:|....|||...   .::
  Fly   318 KCKLVREFFC---------------------------LDEPPSYSESMEECRAIFEAQE---ETI 352

  Fly   496 EDLVL-----CDLFRSID--LRELRGPCFSTIKPSLSRSTLNLLQAVKKRQCASLGHSL 547
            |.|.|     .||..|:.  |||....     |..|..:..|:  .:....|:|...||
  Fly   353 EHLKLQIRNKNDLILSLQQKLREEMNE-----KEQLREAMKNM--ELNCSHCSSASDSL 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SlobNP_001260212.1 PKc 286..481 CDD:270622 35/204 (17%)
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 31/187 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22999
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.