DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6739 and DGCR2

DIOPT Version :10

Sequence 1:NP_609130.1 Gene:CG6739 / 34037 FlyBaseID:FBgn0031926 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_005128.1 Gene:DGCR2 / 9993 HGNCID:2845 Length:550 Species:Homo sapiens


Alignment Length:54 Identity:20/54 - (37%)
Similarity:29/54 - (53%) Gaps:2/54 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   468 LVCEPDEFRCRSNE-KCLVEKYRCDQNIDCMDGSDEQDCDEYGSGDLAPFDESE 520
            |.|.|.:|.|||.. :|:...::||....|.|.|||.:|.|. :|::.|....|
Human    28 LRCNPGQFACRSGTIQCIPLPWQCDGWATCEDESDEANCPEV-TGEVRPHHGKE 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6739NP_609130.1 CRD_FZ 314..427 CDD:143549
LDLa 432..464 CDD:238060
LDLa 470..505 CDD:238060 14/35 (40%)
LDLa 697..731 CDD:238060
DGCR2NP_005128.1 LDLa 30..66 CDD:238060 14/35 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 69..92 3/13 (23%)
CLECT_DGCR2_like 115..267 CDD:153069
VWC 271..329 CDD:214564
PHA03247 <428..537 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 500..550
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.