powered by:
Protein Alignment CG6739 and DGCR2
DIOPT Version :9
Sequence 1: | NP_609130.1 |
Gene: | CG6739 / 34037 |
FlyBaseID: | FBgn0031926 |
Length: | 787 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_005128.1 |
Gene: | DGCR2 / 9993 |
HGNCID: | 2845 |
Length: | 550 |
Species: | Homo sapiens |
Alignment Length: | 54 |
Identity: | 20/54 - (37%) |
Similarity: | 29/54 - (53%) |
Gaps: | 2/54 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 468 LVCEPDEFRCRSNE-KCLVEKYRCDQNIDCMDGSDEQDCDEYGSGDLAPFDESE 520
|.|.|.:|.|||.. :|:...::||....|.|.|||.:|.|. :|::.|....|
Human 28 LRCNPGQFACRSGTIQCIPLPWQCDGWATCEDESDEANCPEV-TGEVRPHHGKE 80
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1215 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.