DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6739 and DGCR2

DIOPT Version :9

Sequence 1:NP_609130.1 Gene:CG6739 / 34037 FlyBaseID:FBgn0031926 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_005128.1 Gene:DGCR2 / 9993 HGNCID:2845 Length:550 Species:Homo sapiens


Alignment Length:54 Identity:20/54 - (37%)
Similarity:29/54 - (53%) Gaps:2/54 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   468 LVCEPDEFRCRSNE-KCLVEKYRCDQNIDCMDGSDEQDCDEYGSGDLAPFDESE 520
            |.|.|.:|.|||.. :|:...::||....|.|.|||.:|.|. :|::.|....|
Human    28 LRCNPGQFACRSGTIQCIPLPWQCDGWATCEDESDEANCPEV-TGEVRPHHGKE 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6739NP_609130.1 CRD_FZ 314..427 CDD:143549
LDLa 432..464 CDD:238060
LDLa 470..505 CDD:238060 14/35 (40%)
LDLa 697..731 CDD:238060
DGCR2NP_005128.1 LDLa 30..66 CDD:238060 14/35 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 69..92 3/13 (23%)
CLECT_DGCR2_like 115..267 CDD:153069
VWC 271..329 CDD:214564
Atrophin-1 <428..537 CDD:331285
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 500..550
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.