DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6739 and LRP8

DIOPT Version :9

Sequence 1:NP_609130.1 Gene:CG6739 / 34037 FlyBaseID:FBgn0031926 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_005271230.1 Gene:LRP8 / 7804 HGNCID:6700 Length:976 Species:Homo sapiens


Alignment Length:423 Identity:94/423 - (22%)
Similarity:127/423 - (30%) Gaps:170/423 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 PLHIGQLP---------PCRRICKAILEACSIPIYNSDVLGELFDCNLYPDAHESHK--CEDP-- 425
            ||..||.|         .||.      |.|...::..|   |..||..:.|..:..|  |.|.  
Human    36 PLLGGQGPAKDCEKDQFQCRN------ERCIPSVWRCD---EDDDCLDHSDEDDCPKKTCADSDF 91

  Fly   426 -------TRRRDYCYGNEFQCHDGS-------------------------CIPQNWQCDKIKDCQ 458
                   ...|..|.|.| :|.|||                         |:|.:|:||..|||:
Human    92 TCDNGHCIHERWKCDGEE-ECPDGSDESEATCTKQVCPAEKLSCGPTSHKCVPASWRCDGEKDCE 155

  Fly   459 GGEDEDEQCLVCEPDEFRCRSNEKCLVEKYRCDQNIDCMDGSDEQDCDEYGSGDLAPFDESELNA 523
            ||.||.....:|.|.||:| .|..||...:.||.:.||.|||||:.|.:...|            
Human   156 GGADEAGCATLCAPHEFQC-GNRSCLAAVFVCDGDDDCGDGSDERGCADPACG------------ 207

  Fly   524 FPRVFTYASFLSPNETNDKVYTYITATTDEDAGTETKFQIHQVAAPAPPVNSSAEEGAGGPKGFV 588
             ||.|....                     |.|                       ||..|:.:|
Human   208 -PREFRCGG---------------------DGG-----------------------GACIPERWV 227

  Fly   589 NFRDSKEIMMTSDSETKFKYSQRANRTSV------KFSVSAPTTPAARTSSAIPSSALVQQRERT 647
                         .:.:|....|::..:.      ..:.|||...|..:..|..|...|....|.
Human   228 -------------CDRQFDCEDRSDEAAELCGRPGPGATSAPAACATASQFACRSGECVHLGWRC 279

  Fly   648 TSTTTTSTTTSTTTSSITSTPSITSTTLIPINAATSEPNPYEVVTSLGGCPPQELRCVSGKCITV 712
            .........:.                              |....||.|...|.:|..|.|:..
Human   280 DGDRDCKDKSD------------------------------EADCPLGTCRGDEFQCGDGTCVLA 314

  Fly   713 SQLCDKQIDCPDAADELMCVY--------RERP 737
            .:.|:::.||||.:||..|:.        |.||
Human   315 IKHCNQEQDCPDGSDEAGCLQVPPTFLGNRRRP 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6739NP_609130.1 CRD_FZ 314..427 CDD:143549 17/72 (24%)
LDLa 432..464 CDD:238060 18/56 (32%)
LDLa 470..505 CDD:238060 17/34 (50%)
LDLa 697..731 CDD:238060 12/33 (36%)
LRP8XP_005271230.1 LDLa 47..81 CDD:238060 9/42 (21%)
LDLa 85..117 CDD:197566 10/32 (31%)
LDLa 127..163 CDD:238060 12/35 (34%)
LDLa 206..240 CDD:197566 12/103 (12%)
Ldl_recept_a 262..294 CDD:278486 5/61 (8%)
Ldl_recept_a 298..333 CDD:278486 12/34 (35%)
FXa_inhibition 353..387 CDD:291342
EGF_CA 389..419 CDD:214542
LY 458..493 CDD:214531
LY 502..544 CDD:214531
Ldl_recept_b 565..605 CDD:278487
LY 589..631 CDD:214531
Ldl_recept_b 652..691 CDD:278487
FXa_inhibition 710..747 CDD:291342
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.