DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6739 and lrp1ba

DIOPT Version :9

Sequence 1:NP_609130.1 Gene:CG6739 / 34037 FlyBaseID:FBgn0031926 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_021325253.1 Gene:lrp1ba / 565136 ZFINID:ZDB-GENE-050208-608 Length:4654 Species:Danio rerio


Alignment Length:521 Identity:116/521 - (22%)
Similarity:171/521 - (32%) Gaps:188/521 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 TLTRVSPTLPPPLSASGRPTEAMA-------------LTTP-------STTNSGCQSTMLPMCQG 324
            ||:|...|      :.|:.||.::             |..|       ..||.||....|....|
Zfish  3243 TLSRSHKT------SGGKQTELLSSWQTIRDIQVYHPLRQPDVPKHQCQVTNGGCSHLCLLSPGG 3301

  Fly   325 VLDYDLTFNREGAAPRDAVSMAAYDSLIRANCSVRAAEFICGALEPECRPL--------HIG--- 378
                    ..:.|.|.. ..:|..:....:||:  |::|.||.  .||.|.        ..|   
Zfish  3302 --------GYKCACPTH-FYLANDNKTCLSNCT--ASQFRCGT--DECIPFWWKCDTVDDCGDGS 3353

  Fly   379 ---------QLPPCRRICKAILEACSIPIYNSDVLGELFDCNLYPDAHESHKCEDPTRRRDY-CY 433
                     :..|.|..|...|  |::|.:..|  || .||.   |..:...|:      .| |.
Zfish  3354 DEPADCPEFKCQPGRFQCGTGL--CALPPFICD--GE-NDCG---DNSDEANCD------SYICL 3404

  Fly   434 GNEFQC-HDGSCIPQNWQCDKIKDCQGGEDEDEQC--LVCEPDEFRCRSNEKCLVEKYRCDQNID 495
            ..:|:| |...|||.|.:|:...||..||||.: |  ..|.|.:|:|:|...|:.:.:.||::.|
Zfish  3405 SGQFKCTHRQKCIPINLRCNGQDDCGDGEDETD-CPENTCSPSQFQCKSTMHCISKLWVCDEDPD 3468

  Fly   496 CMDGSDEQDCDEY----------------------GSGDLAPFDESELNAFPRVFTYASFLSPNE 538
            |.|||||.:|||.                      |..|.:...:.| |..|......:|:..| 
Zfish  3469 CADGSDEANCDEKTCGPHEFRCKDNNCIPDHWRCDGQSDCSDNSDEE-NCKPVTCNSKNFICAN- 3531

  Fly   539 TNDKVYTYITATTDEDAGTETKFQIHQVAAPAPPVNSSAEEGAGGPKGFVNFRDSKEIMMTSDSE 603
             .:.:.:......|.|.                 .::|.|.|.                .:..||
Zfish  3532 -GECISSRFRCDGDFDC-----------------TDNSDERGC----------------ESHCSE 3562

  Fly   604 TKFKYSQRANR--TSVKFSVSAPTTPAARTSSAIPSSALVQQRERTTSTTTTSTTTSTTTSSITS 666
            .:|   |..|.  .|||:....                     :....|.......|...:::|:
Zfish  3563 DQF---QCLNHLCISVKWLCDG---------------------QEDCKTGEDEANCSPANTAMTA 3603

  Fly   667 TPSITSTTLIPINAATSEPNPYEVVTSLGGCPPQELRCVSGKCITVSQLCDKQIDCPDAADELMC 731
            .|:                          .|...|..||.|.|:..:|.||.|.||.|.:||:.|
Zfish  3604 RPT--------------------------ACGLNEYVCVGGGCVLAAQRCDGQNDCADGSDEVDC 3642

  Fly   732 V 732
            :
Zfish  3643 L 3643

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6739NP_609130.1 CRD_FZ 314..427 CDD:143549 29/132 (22%)
LDLa 432..464 CDD:238060 14/32 (44%)
LDLa 470..505 CDD:238060 15/34 (44%)
LDLa 697..731 CDD:238060 15/33 (45%)
lrp1baXP_021325253.1 LDLa 30..62 CDD:197566
LDLa 74..107 CDD:197566
FXa_inhibition 163..191 CDD:317114
LY 276..309 CDD:214531
LY 317..359 CDD:214531
LY 362..402 CDD:214531
FXa_inhibition 487..519 CDD:317114
LY 553..593 CDD:214531
LY 594..633 CDD:214531
LY 640..689 CDD:214531
LY 690..732 CDD:214531
FXa_inhibition 801..838 CDD:317114
LDLa 891..924 CDD:238060
LDLa 974..1007 CDD:238060
LDLa 1011..1042 CDD:197566
LDLa 1057..1092 CDD:238060
LDLa 1104..1135 CDD:238060
LDLa 1140..1173 CDD:197566
FXa_inhibition 1180..1216 CDD:317114
LY 1284..1322 CDD:214531
LY 1331..1370 CDD:214531
LY 1375..1418 CDD:214531
LY <1430..1463 CDD:214531
LY 1604..1643 CDD:214531
LY 1645..1687 CDD:214531
LY 1689..1728 CDD:214531
LY <1739..1770 CDD:214531
FXa_inhibition 1842..1878 CDD:317114
NHL 1923..>2095 CDD:302697
NHL repeat 1923..1956 CDD:271320
NHL repeat 1961..1996 CDD:271320
NHL repeat 2002..2040 CDD:271320
NHL repeat 2043..2084 CDD:271320
FXa_inhibition 2151..2186 CDD:317114
LY 2265..2305 CDD:214531
Ldl_recept_b 2334..2375 CDD:278487
LY 2359..2401 CDD:214531
FXa_inhibition 2472..2506 CDD:317114
LDLa 2518..2547 CDD:238060
LDLa 2556..2590 CDD:238060
LDLa 2595..2629 CDD:238060
LDLa <2652..2681 CDD:294076
LDLa 2689..2723 CDD:238060
LDLa 2727..2758 CDD:238060
LDLa 2768..2801 CDD:238060
LDLa 2811..2843 CDD:197566
LDLa 2852..2884 CDD:197566
LDLa 2898..2932 CDD:238060
cEGF 2955..2978 CDD:315355
EGF_CA 2975..3005 CDD:214542
LY 3042..3086 CDD:214531
LY 3088..3125 CDD:214531
Ldl_recept_b 3149..3189 CDD:278487
LY 3173..3213 CDD:214531
FXa_inhibition 3284..3320 CDD:317114 9/44 (20%)
LDLa 3324..3355 CDD:197566 9/34 (26%)
LDLa 3364..3398 CDD:238060 12/41 (29%)
LDLa 3403..3438 CDD:238060 15/35 (43%)
LDLa 3443..3478 CDD:238060 15/34 (44%)
LDLa 3483..3517 CDD:238060 3/34 (9%)
LDLa 3522..3556 CDD:238060 6/52 (12%)
LDLa 3560..3594 CDD:238060 9/57 (16%)
LDLa 3608..3642 CDD:238060 15/33 (45%)
LDLa 3646..3681 CDD:238060
LDLa 3688..3720 CDD:238060
LDLa 3729..3765 CDD:238060
LDLa 3775..3809 CDD:238060
Ldl_recept_b 4051..4091 CDD:278487
LY 4075..4116 CDD:214531
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.