Sequence 1: | NP_609130.1 | Gene: | CG6739 / 34037 | FlyBaseID: | FBgn0031926 | Length: | 787 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_057663.1 | Gene: | CD320 / 51293 | HGNCID: | 16692 | Length: | 282 | Species: | Homo sapiens |
Alignment Length: | 196 | Identity: | 50/196 - (25%) |
---|---|---|---|
Similarity: | 74/196 - (37%) | Gaps: | 60/196 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 432 CYGNEFQCH-DGSCIPQNWQCDKIKDCQGGEDEDE----------QC------------------ 467
Fly 468 -----------LVCEPDEFRCRSNEKCLVEKYRCDQNIDCMDGSDEQDCDEYGSGDLAPFDESEL 521
Fly 522 NAFPRVFTYASFLSPNETNDKVYTYITATTDEDAGTETKFQIHQVAAPAPPVNSSAEEGAGGPKG 586
Fly 587 F 587 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6739 | NP_609130.1 | CRD_FZ | 314..427 | CDD:143549 | |
LDLa | 432..464 | CDD:238060 | 14/32 (44%) | ||
LDLa | 470..505 | CDD:238060 | 14/34 (41%) | ||
LDLa | 697..731 | CDD:238060 | |||
CD320 | NP_057663.1 | LDLa | 54..89 | CDD:238060 | 15/34 (44%) |
LDLa | 132..167 | CDD:238060 | 14/34 (41%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1215 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |