DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6739 and arr

DIOPT Version :9

Sequence 1:NP_609130.1 Gene:CG6739 / 34037 FlyBaseID:FBgn0031926 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_524737.2 Gene:arr / 44279 FlyBaseID:FBgn0000119 Length:1678 Species:Drosophila melanogaster


Alignment Length:522 Identity:115/522 - (22%)
Similarity:170/522 - (32%) Gaps:167/522 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 TEAMALTTPST----------TNSGCQSTMLPMCQGVLDYDLTFNREGAAPRDAVSMAAYDSLI- 352
            |:..|:.||..          :.:.|....:...:|:           |..||..|...:..|: 
  Fly  1255 TDIRAVWTPDPKVLRNHTCMHSRTKCSHICIASGEGI-----------ARTRDVCSCPKHLMLLE 1308

  Fly   353 -RANCSVRAAEFICGALEPECRPLHIGQLPPCRRICKAILEACSIPI-----YNSDVLGELFDCN 411
             :.|         |||. |.|.|.|.               .|:.|:     .|.|.:...:.|:
  Fly  1309 DKEN---------CGAF-PACGPDHF---------------TCAAPVSGISDVNKDCIPASWRCD 1348

  Fly   412 LY---PDAHESHKCEDPTRRRDYCYGNEFQCHDGSCIPQNWQCDKIKDCQGGEDEDEQCLVCEPD 473
            ..   ||..:...|  ||     |..::|.|..|.||.::..||...:|..|.||.:.|.  .|.
  Fly  1349 GQKDCPDKSDEVGC--PT-----CRADQFSCQSGECIDKSLVCDGTTNCANGHDEADCCK--RPG 1404

  Fly   474 EFRCRSNEKCLVEKYRCDQNIDCMDGSDEQDCDEYGSGD------LAPFDESELNAFP------- 525
            ||:|..|:.|:.....||...:|.||:||       |.|      :||  .::..||.       
  Fly  1405 EFQCPINKLCISAALLCDGWENCADGADE-------SSDICLQRRMAP--ATDKRAFMILIGATM 1460

  Fly   526 -RVFTYASFL---------SPNETNDKVYTYITATTDEDAGTETKFQ-IHQVAAPAPPVNSSAEE 579
             .:|:....|         |..|..|.     .||......|.:|.| :.::|:.|..|..|...
  Fly  1461 ITIFSIVYLLQFCRTRIGKSRTEPKDD-----QATDPLSPSTLSKSQRVSKIASVADAVRMSTLN 1520

  Fly   580 GAGGPKGFVNFRDSKEIMMTSDSETKFKYSQRANRTSVKFSVSAPTTPAARTSSAIPSSALVQQR 644
            .    :..:|..|...|...|.|.|.       ..:.|.:.::.|.:||.|:........::.|.
  Fly  1521 S----RNSMNSYDRNHITGASSSTTN-------GSSMVAYPINPPPSPATRSRRPYRHYKIINQP 1574

  Fly   645 ERTT--STTTTSTTTSTTTSSITSTPSITSTTLIPINAAT--------SEPNPYEVVTSLGGCPP 699
            ...|  ||.....:.|..||...|..|....|....::|.        |||.|          ||
  Fly  1575 PPPTPCSTDICDESDSNYTSKSNSNNSNGGATKHSSSSAAACLQYGYDSEPYP----------PP 1629

  Fly   700 --------QELRCVSGKCITVSQLCDKQIDCPDAADELMCVYRERPSRRRLT--STTAPPTTSSA 754
                    .::|.|            .:..||.:           ||.|..|  |...||.:...
  Fly  1630 PTPRSHYHSDVRIV------------PESSCPPS-----------PSSRSSTYFSPLPPPPSPVQ 1671

  Fly   755 PP 756
            .|
  Fly  1672 SP 1673

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6739NP_609130.1 CRD_FZ 314..427 CDD:143549 24/122 (20%)
LDLa 432..464 CDD:238060 11/31 (35%)
LDLa 470..505 CDD:238060 13/34 (38%)
LDLa 697..731 CDD:238060 6/41 (15%)
arrNP_524737.2 LY 162..201 CDD:214531
NHL 168..503 CDD:302697
NHL repeat 172..237 CDD:271320
LY 252..293 CDD:214531
NHL repeat 261..298 CDD:271320
NHL repeat 303..339 CDD:271320
NHL repeat 341..419 CDD:271320
NHL repeat 428..476 CDD:271320
LY 472..511 CDD:214531
NHL repeat 477..503 CDD:271320
Ldl_recept_b 534..573 CDD:278487
LY 558..599 CDD:214531
LY 600..641 CDD:214531
FXa_inhibition 668..703 CDD:291342
LY 739..773 CDD:214531
LY 776..818 CDD:214531
LY 819..860 CDD:214531
FXa_inhibition 973..1010 CDD:291342
LY 1122..1164 CDD:214531
FXa_inhibition 1273..1313 CDD:291342 8/59 (14%)
LDLa 1319..1362 CDD:238060 10/57 (18%)
LDLa 1365..1399 CDD:238060 12/33 (36%)
LDLa 1399..1433 CDD:197566 12/35 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.