DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6739 and dgcr2

DIOPT Version :10

Sequence 1:NP_609130.1 Gene:CG6739 / 34037 FlyBaseID:FBgn0031926 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_073769891.1 Gene:dgcr2 / 436929 ZFINID:ZDB-GENE-040718-404 Length:543 Species:Danio rerio


Alignment Length:118 Identity:29/118 - (24%)
Similarity:43/118 - (36%) Gaps:43/118 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   426 TRRRDYCYGNEFQCHDGSCIPQNWQCDKIKDCQGGEDEDEQC-----------------LVCEPD 473
            |||:..|.                .|:::.|.:......| |                 |.|.|.
Zfish     3 TRRQTVCL----------------TCERLVDEKSASSISE-CVCLSAGPRLALARLLTDLRCNPG 50

  Fly   474 EFRCRSNE-KCLVEKYRCDQNIDCMDGSDEQDCD-------EYGSGDLAPFDE 518
            :|.|||.: :|:...::||....|.|.|||.||.       .|.:| |.|.::
Zfish    51 QFACRSGKLQCIPSTWQCDGWTACEDKSDEIDCPTIKEERYRYSNG-LEPVED 102

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity