DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6739 and dgcr2

DIOPT Version :9

Sequence 1:NP_609130.1 Gene:CG6739 / 34037 FlyBaseID:FBgn0031926 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_001002656.1 Gene:dgcr2 / 436929 ZFINID:ZDB-GENE-040718-404 Length:536 Species:Danio rerio


Alignment Length:116 Identity:28/116 - (24%)
Similarity:43/116 - (37%) Gaps:29/116 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   432 CYGNEFQCHDG--SCIPQNWQCDKIKDCQGGEDEDEQCLVCEPDEFR-----------------C 477
            |...:|.|..|  .|||..||||....|:...||.: |...:.:.:|                 .
Zfish    40 CNPGQFACRSGKLQCIPSTWQCDGWTACEDKSDEID-CPTIKEERYRYSNGLEPVEDVMGVAQPV 103

  Fly   478 RSNEKCLVEKYRCDQNIDCMD---GSDE-----QDCDEYGSGDLAPFDESE 520
            |.|:||....:..::...|..   .|:.     :.|.:. :|.||.|..:|
Zfish   104 RFNKKCPSGWHHYEKTASCYKVYLRSENYWQAVETCQKV-NGSLATFGTNE 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6739NP_609130.1 CRD_FZ 314..427 CDD:143549
LDLa 432..464 CDD:238060 13/33 (39%)
LDLa 470..505 CDD:238060 7/59 (12%)
LDLa 697..731 CDD:238060
dgcr2NP_001002656.1 LDLa 40..76 CDD:238060 14/36 (39%)
CLECT_DGCR2_like 109..263 CDD:153069 9/46 (20%)
VWC 267..325 CDD:214564
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.