DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6739 and LRP5

DIOPT Version :9

Sequence 1:NP_609130.1 Gene:CG6739 / 34037 FlyBaseID:FBgn0031926 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_011543331.1 Gene:LRP5 / 4041 HGNCID:6697 Length:1662 Species:Homo sapiens


Alignment Length:391 Identity:74/391 - (18%)
Similarity:95/391 - (24%) Gaps:229/391 - (58%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 CRRICKAILEA---CSIPIYNSDVLGELFDCNLYPDAHESHKCEDPTRRRDYCYGNEFQCHDG-- 442
            |..||.|..:.   ||.|:: ..:|..|..|.           |.||     |..::|.|..|  
Human  1233 CSHICIAKGDGTPRCSCPVH-LVLLQNLLTC
G-----------EPPT-----CSPDQFACATGEI 1280

  Fly   443 SCIPQNWQCDKIKDCQGGEDEDEQCLVCEPDEFRCRSNEKCLVEKYRCDQNIDCMDGSDEQDCDE 507
            .|||..|:||...:|....|| |.|.||...:|.| :..:|:..:.|||...||.|.|||.||| 
Human  1281 DCIPGAWRCDGFPECDDQSDE-EGCPVCSAAQFPC-ARGQCVDLRLRCDGEADCQDRSDEADCD- 1342

  Fly   508 YGSGDLAPFDESELNAFPRVFTYASFLSPNETNDKVYTYITATTDEDAGTETKFQIHQVAAPAPP 572
                                                                             
Human  1343 ----------------------------------------------------------------- 1342

  Fly   573 VNSSAEEGAGGPKGFVNFRDSKEIMMTSDSETKFKYSQRANRTSVKFSVSAPTTPAARTSSAIPS 637
                                                                         ||  
Human  1343 -------------------------------------------------------------AI-- 1344

  Fly   638 SALVQQRERTTSTTTTSTTTSTTTSSITSTPSITSTTLIPINAATSEPNPYEVVTSLGGCPPQEL 702
                                                                       |.|.:.
Human  1345 -----------------------------------------------------------CLPNQF 1350

  Fly   703 RCVSGKCITVSQLCDKQIDCPDAADELMCVYRERPSRRRLTSTTAPPTTSSAPPETSTATTTTGP 767
            ||.||:|:.:.|.||...||.|.:|||||            ..|.||:..|  |..|:|   .||
Human  1351 RCASGQCVLIKQQCDSFPDCIDGSDELMC------------EITKPPSDDS--PAHSSA---IGP 1398

  Fly   768 L 768
            :
Human  1399 V 1399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6739NP_609130.1 CRD_FZ 314..427 CDD:143549 12/46 (26%)
LDLa 432..464 CDD:238060 12/33 (36%)
LDLa 470..505 CDD:238060 13/34 (38%)
LDLa 697..731 CDD:238060 16/33 (48%)
LRP5XP_011543331.1 NHL <46..>178 CDD:302697
NHL repeat 74..113 CDD:271320
LY 111..151 CDD:214531
NHL repeat 116..157 CDD:271320
Ldl_recept_b 172..212 CDD:278487
LY 196..238 CDD:214531
FXa_inhibition 308..345 CDD:291342
LY 375..415 CDD:214531
LY 417..459 CDD:214531
LY 460..503 CDD:214531
LY 504..546 CDD:214531
LY 547..580 CDD:214531
FXa_inhibition 614..649 CDD:291342
NHL 694..887 CDD:302697
LY 719..761 CDD:214531
NHL repeat 729..765 CDD:271320
NHL repeat 772..811 CDD:271320
NHL repeat 856..880 CDD:271320
FXa_inhibition 915..950 CDD:291342
LY 979..1018 CDD:214531
LY 1069..1112 CDD:214531
LY 1113..1155 CDD:214531
FXa_inhibition 1226..1262 CDD:291342 9/29 (31%)
Ldl_recept_a 1267..1304 CDD:278486 15/42 (36%)
LDLa 1307..1341 CDD:238060 13/34 (38%)
LDLa 1345..1379 CDD:238060 16/33 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.