DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6739 and LRP4

DIOPT Version :9

Sequence 1:NP_609130.1 Gene:CG6739 / 34037 FlyBaseID:FBgn0031926 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_002325.2 Gene:LRP4 / 4038 HGNCID:6696 Length:1905 Species:Homo sapiens


Alignment Length:425 Identity:88/425 - (20%)
Similarity:134/425 - (31%) Gaps:171/425 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   337 AAPRDAVSMAAYDSLIRA--NCSVRAAEFIC-------------GALEPECRPLHIGQLPPCRRI 386
            ::|..|...:.:...:.|  .|:...|::.|             |.:.|.|.||..         
Human    21 SSPECACGRSHFTCAVSALGECTCIPAQWQCDGDNDCGDHSDEDGCILPTCSPLDF--------- 76

  Fly   387 CKAILEACSIPIYNSDVLGELFDCNLYPDAHESHKCEDPTRRRD----YCYGNEFQCHDGSCIPQ 447
                  .|.    |...:...:.|:      ..:.|||.:..:|    .|..:||.|.:|.||..
Human    77 ------HCD----NGKCIRRSWVCD------GDNDCEDDSDEQDCPPRECEEDEFPCQNGYCIRS 125

  Fly   448 NWQCDKIKDCQGGEDEDEQCLV--CEPDEFRCRSNEKCLVEKYRCDQNIDCMDGSDEQDCDEYGS 510
            .|.||...||  |::.||||.:  |...|||| |:..|:.|.:.||.:.||.|||||::|..   
Human   126 LWHCDGDNDC--GDNSDEQCDMRKCSDKEFRC-SDGSCIAEHWYCDGDTDCKDGSDEENCPS--- 184

  Fly   511 GDLAPFDESELNAFPRVFTYASFLSPNETNDKVYTYITATTDEDAGTETKFQIHQVAAPAPPVNS 575
                                                                    |.||||.|.
Human   185 --------------------------------------------------------AVPAPPCNL 193

  Fly   576 SAEEGAGGPKGFVNFRDSKEIMMTSDSETKFKYSQRANRTSVKFSVSAPTTPAARTSSAIPSSAL 640
            ...:.|.|       |...:|......:....:|..::.:|.:         ..|:...:..|.|
Human   194 EEFQCAYG-------RCILDIYHCDGDDDCGDWSDESDCSSHQ---------PCRSGEFMCDSGL 242

  Fly   641 VQQRERTTSTTTTSTTTSTTTSSITSTPSITSTTLIPINA---------ATSEPNPYEVVTSLGG 696
            .                                    |||         ...:.:.....||:  
Human   243 C------------------------------------INAGWRCDGDADCDDQSDERNCTTSM-- 269

  Fly   697 CPPQELRCVSGKCITVSQLCDKQIDCPDAADELMC 731
            |..::.||.||:|:.:|..||.:.||.|.:||..|
Human   270 CTAEQFRCHSGRCVRLSWRCDGEDDCADNSDEENC 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6739NP_609130.1 CRD_FZ 314..427 CDD:143549 17/104 (16%)
LDLa 432..464 CDD:238060 13/31 (42%)
LDLa 470..505 CDD:238060 17/34 (50%)
LDLa 697..731 CDD:238060 14/33 (42%)
LRP4NP_002325.2 LDLa 27..66 CDD:238060 4/38 (11%)
Ldl_recept_a 70..105 CDD:278486 9/59 (15%)
LDLa 110..142 CDD:238060 14/33 (42%)
LDLa 148..182 CDD:238060 17/34 (50%)
LDLa 231..265 CDD:238060 6/69 (9%)
LDLa 270..304 CDD:238060 14/33 (42%)
LDLa 311..343 CDD:197566
FXa_inhibition 358..393 CDD:291342
EGF_CA 395..434 CDD:214542
NHL <471..622 CDD:302697
NHL repeat 471..507 CDD:271320
LDL-receptor class B 1 480..522
LY 505..545 CDD:214531
NHL repeat 510..550 CDD:271320
LDL-receptor class B 2 523..565
NHL repeat 555..589 CDD:271320
LDL-receptor class B 3 566..609
LY 590..632 CDD:214531
NHL repeat 598..622 CDD:271320
LDL-receptor class B 4 610..652
LY 633..673 CDD:214531
LDL-receptor class B 5 653..693
FXa_inhibition 702..>729 CDD:291342
LY 766..806 CDD:214531
LDL-receptor class B 6 785..827
LY 808..850 CDD:214531
LDL-receptor class B 7 828..870
LDL-receptor class B 8 871..914
Ldl_recept_b 871..911 CDD:278487
LY 895..937 CDD:214531
LDL-receptor class B 9 915..956
LY 938..979 CDD:214531
LDL-receptor class B 10 957..998
FXa_inhibition 1006..1043 CDD:291342
NHL <1085..1277 CDD:302697
NHL repeat 1085..1123 CDD:271320
LDL-receptor class B 11 1093..1135
NHL repeat 1128..1161 CDD:271320
LDL-receptor class B 12 1136..1178
NHL repeat 1166..1203 CDD:271320
LDL-receptor class B 13 1179..1222
Ldl_recept_b 1179..1219 CDD:278487
NHL repeat 1212..1244 CDD:271320
LDL-receptor class B 14 1223..1263
NHL repeat 1253..1277 CDD:271320
LDL-receptor class B 15 1264..1306
FXa_inhibition 1313..1348 CDD:291342
LY 1379..1418 CDD:214531
LDL-receptor class B 16 1397..1439
LY 1420..1460 CDD:214531
LDL-receptor class B 17 1440..1482
LDL-receptor class B 18 1483..1526
Ldl_recept_b 1483..1523 CDD:278487
LY 1507..1547 CDD:214531
LDL-receptor class B 19 1527..1568
LY 1549..1589 CDD:214531
LDL-receptor class B 20 1569..1610
FXa_inhibition 1617..>1641 CDD:291342
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1659..1686
Endocytosis signal. /evidence=ECO:0000255 1766..1769
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1852..1905
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.