DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6739 and LRP3

DIOPT Version :9

Sequence 1:NP_609130.1 Gene:CG6739 / 34037 FlyBaseID:FBgn0031926 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_005259002.1 Gene:LRP3 / 4037 HGNCID:6695 Length:785 Species:Homo sapiens


Alignment Length:338 Identity:84/338 - (24%)
Similarity:119/338 - (35%) Gaps:89/338 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   432 CYGNEFQCHDGSCIPQNWQCDKIKDCQGGEDEDEQC---------LVCEPDEFRCRS--NEKCLV 485
            |..:||:|.:|.|:|..|||:.:.:|..|.||. .|         .:|....|.|..  :.:||.
Human   166 CQADEFRCDNGKCLPGPWQCNTVDECGDGSDEG-NCSAPASEPPGSLCPGGTFPCSGARSTRCLP 229

  Fly   486 EKYRCDQNIDCMDGSDEQDCDEYGSGDLAPFDESELNAFPRVFTYASFLSPN------ETNDKVY 544
            .:.|||...||.|||||..|.:...|       ..|.:|     |.||.||:      ..:|...
Human   230 VERRCDGLQDCGDGSDEAGCPDLACG-------RRLGSF-----YGSFASPDLFGAARGPSDLHC 282

  Fly   545 TYITATTDE---------DAGTETKFQIHQVAAPAPPVNSSAEEGAGGPKGFVNFRDSKEIMMTS 600
            |::..|.|.         ..|.:...|::              ||.|        .....::.| 
Human   283 TWLVDTQDSRRVLLQLELRLGYDDYVQVY--------------EGLG--------ERGDRLLQT- 324

  Fly   601 DSETKFKYSQRANRTSVKF-SVSAPTTPA--ARTSSAIPS-SALVQQR------ERTTSTTTTST 655
                   .|.|:|...|.. :.....|.|  ||..||... :|..|.:      |:...:::.|.
Human   325 -------LSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNATYQVKGYCLPWEQPCGSSSDSD 382

  Fly   656 TTSTTTSSITSTPSITSTTLIPINAATSEPNPYEVVTSLGGCPPQELRCV--SGKCITVSQLCDK 718
            ..|.......|.|..........:....:..|        .|||.:..|.  ||.|.|.:..|:.
Human   383 GGSLGDQGCFSEPQRCDGWWHCASGRDEQGCP--------ACPPDQYPCEGGSGLCYTPADRCNN 439

  Fly   719 QIDCPDAADELMC 731
            |..|||.|||..|
Human   440 QKSCPDGADEKNC 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6739NP_609130.1 CRD_FZ 314..427 CDD:143549
LDLa 432..464 CDD:238060 13/31 (42%)
LDLa 470..505 CDD:238060 15/36 (42%)
LDLa 697..731 CDD:238060 16/35 (46%)
LRP3XP_005259002.1 CUB 43..156 CDD:238001
LDLa 166..200 CDD:238060 14/34 (41%)
LDLa 212..249 CDD:238060 15/36 (42%)
CUB 254..364 CDD:238001 29/151 (19%)
LDLa 416..452 CDD:238060 16/35 (46%)
LDLa 455..489 CDD:238060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.