DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6739 and vldlr

DIOPT Version :9

Sequence 1:NP_609130.1 Gene:CG6739 / 34037 FlyBaseID:FBgn0031926 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_005155618.1 Gene:vldlr / 393897 ZFINID:ZDB-GENE-040426-803 Length:877 Species:Danio rerio


Alignment Length:461 Identity:106/461 - (22%)
Similarity:149/461 - (32%) Gaps:175/461 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 MLPMCQGVLDYDLTFNREGAAPRDAVSMAAYDSLIRANCSVRAAEFICGALEPECRPLHIGQLPP 382
            :||:|                    ..:..:....||.|  ..::|.||  ...|.|    .:..
Zfish    11 LLPVC--------------------FQLWGFSRASRAEC--EQSQFQCG--NGRCIP----SVWQ 47

  Fly   383 C----------------RRICKAILEACSIPIYNSDVLGELFDCNLYPDAHESHKCED------- 424
            |                |:.|..:...|.    :...:.:.:.|:..||      |||       
Zfish    48 CDGDMDCSDGSDETSCVRKTCAEVDFVCR----SGQCIPKRWQCDGEPD------CEDGSDESIE 102

  Fly   425 --PTRRRDYCYGNEFQCHDGS--CIPQNWQCDKIKDCQGGEDEDEQC--LVCEPDEFRCRSNEKC 483
              .||.   |..|||.|..||  |||..|:||..|||..|||| ..|  :.|.|.||.| |:.:|
Zfish   103 MCHTRT---CRVNEFSCGVGSTQCIPVFWKCDGEKDCDNGEDE-INCGNITCAPLEFTC-SSGRC 162

  Fly   484 LVEKYRCDQNIDCMDGSDEQDCDEYGSGDLAPFDESELNAFPRVFTYASFLSPNETNDKVYTYIT 548
            :..|:.|:...||.||||||||        ||                |..||:|......|.|.
Zfish   163 VSRKFVCNGEDDCGDGSDEQDC--------AP----------------SSCSPSEIPCGNNTCIP 203

  Fly   549 AT--TDEDAGTETKFQI------HQVAAPAPPVNSSAEE---GAG----------GPKGFVNFRD 592
            .:  .|:|...:.:...      |.   |.||...|..|   |:|          |.....:..|
Zfish   204 RSWLCDDDVDCQDQSDESPERCGHN---PTPPAKCSPSEMQCGSGECIHRKWRCDGDPDCKDGSD 265

  Fly   593 SKEIMMTSDSETKFKYSQRANRTSVKFSVSAPTTPAARTSSAIPSSALVQQRERTTSTTTTSTTT 657
            .|.....:....:||...                     .|.|..                |...
Zfish   266 EKNCSARNCRPDQFKCDD---------------------GSCIHG----------------SRQC 293

  Fly   658 STTTSSITSTPSITSTTLIPINAATSEPNPYEVVTSLGGCPPQELRCVSGKCITVSQLCDKQIDC 722
            :.....:..|..:....|...|::                  .:.:|.||:||.:|::|:|..||
Zfish   294 NGFRDCVDGTDEVNCKNLTQCNSS------------------DQFKCRSGECIEMSKVCNKVRDC 340

  Fly   723 PDAADE 728
            ||.:||
Zfish   341 PDWSDE 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6739NP_609130.1 CRD_FZ 314..427 CDD:143549 21/133 (16%)
LDLa 432..464 CDD:238060 19/33 (58%)
LDLa 470..505 CDD:238060 17/34 (50%)
LDLa 697..731 CDD:238060 14/32 (44%)
vldlrXP_005155618.1 LDLa 29..63 CDD:238060 7/41 (17%)
LDLa 67..99 CDD:197566 8/41 (20%)
Ldl_recept_a 107..145 CDD:278486 21/41 (51%)
Ldl_recept_a 149..184 CDD:278486 17/35 (49%)
Ldl_recept_a 234..269 CDD:278486 7/34 (21%)
Ldl_recept_a 272..308 CDD:278486 6/72 (8%)
LDLa 316..346 CDD:238060 12/47 (26%)
FXa_inhibition 356..390 CDD:291342
EGF_CA 392..426 CDD:214542
NHL 479..>570 CDD:302697
LY 504..541 CDD:214531
NHL repeat 511..551 CDD:271320
Ldl_recept_b 564..604 CDD:278487
LY 588..630 CDD:214531
Ldl_recept_b 651..690 CDD:278487
FXa_inhibition 707..745 CDD:291342
Mucin <723..817 CDD:250634
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.